Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
285489
Gene name Gene Name - the full gene name approved by the HGNC.
Docking protein 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DOK7
Synonyms (NCBI Gene) Gene synonyms aliases
C4orf25, CMS10, CMS1B, FADS3
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p16.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is essential for neuromuscular synaptogenesis. The protein functions in aneural activation of muscle-specific receptor kinase, which is required for postsynaptic differentiation, and in the subsequent clustering of the ace
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs118203994 G>A,C Pathogenic Stop gained, coding sequence variant, 5 prime UTR variant, missense variant
rs118203995 C>G,T Pathogenic Missense variant, coding sequence variant, 5 prime UTR variant, stop gained
rs139468087 C>A,G,T Conflicting-interpretations-of-pathogenicity, likely-benign 3 prime UTR variant, coding sequence variant, synonymous variant
rs141947707 C>G,T Likely-benign, conflicting-interpretations-of-pathogenicity 3 prime UTR variant, synonymous variant, 5 prime UTR variant, coding sequence variant
rs142821143 C>G,T Uncertain-significance, conflicting-interpretations-of-pathogenicity 3 prime UTR variant, missense variant, 5 prime UTR variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019810 hsa-miR-375 Microarray 20215506
MIRT022616 hsa-miR-124-3p Microarray 18668037
MIRT943208 hsa-miR-1207-5p CLIP-seq
MIRT943209 hsa-miR-1224-3p CLIP-seq
MIRT943210 hsa-miR-1231 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005654 Component Nucleoplasm IDA
GO:0005739 Component Mitochondrion IDA
GO:0005886 Component Plasma membrane IEA
GO:0007167 Process Enzyme-linked receptor protein signaling pathway IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610285 26594 ENSG00000175920
Protein
UniProt ID Q18PE1
Protein name Protein Dok-7 (Downstream of tyrosine kinase 7)
Protein function Probable muscle-intrinsic activator of MUSK that plays an essential role in neuromuscular synaptogenesis. Acts in aneural activation of MUSK and subsequent acetylcholine receptor (AchR) clustering in myotubes. Induces autophosphorylation of MUSK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02174 IRS 110 204 PTB domain (IRS-1 type) Domain
Tissue specificity TISSUE SPECIFICITY: Preferentially expressed in skeletal muscle and heart. Present in thigh muscle, diaphragm and heart but not in the liver or spleen (at protein level). {ECO:0000269|PubMed:16794080}.
Sequence
MTEAALVEGQVKLRDGKKWKSRWLVLRKPSPVADCLLMLVYKDKSERIKGLRERSSLTLE
DICGLEPGLPYEGLVHTLAIVCLSQAIMLGFDSHEAMCAWDARIRYALGEVHRFHVTVAP
GTKLESGPATLHLCNDVLVLARDIPPAVTGQWKLSDLRRYGAVPSGFIFEGGTRCGYWAG
VFFLSSAEGEQISFLFDCIVRGIS
PTKGPFGLRPVLPDPSPPGPSTVEERVAQEALETLQ
LEKRLSLLSHAGRPGSGGDDRSLSSSSSEASHLDVSASSRLTAWPEQSSSSASTSQEGPR
PAAAQAAGEAMVGASRPPPKPLRPRQLQEVGRQSSSDSGIATGSHSSYSSSLSSYAGSSL
DVWRATDELGSLLSLPAAGAPEPSLCTCLPGTVEYQVPTSLRAHYDTPRSLCLAPRDHSP
PSQGSPGNSAARDSGGQTSAGCPSGWLGTRRRGLVMEAPQGSEATLPGPAPGEPWEAGGP
HAGPPPAFFSACPVCGGLKVNPPP
Sequence length 504
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Akinesia Fetal akinesia deformation sequence 3, Fetal akinesia deformation sequence 1 rs1349476281, rs768892432, rs606231131, rs778172294, rs761899995, rs794727884, rs606231132, rs769850502, rs1560224831, rs797045528, rs606231129, rs1560200925, rs118203995, rs770987150, rs775583136
View all (2 more)
N/A
Myasthenic Syndrome Congenital myasthenic syndrome, Congenital myasthenic syndrome 10 rs770987150, rs606231131, rs1577153124, rs794727884, rs778172294, rs761899995, rs1349476281, rs606231132, rs606231128, rs768892432, rs762345055, rs797045040, rs118203994, rs797045528, rs606231129
View all (9 more)
N/A
Rett Syndrome rett syndrome rs606231129 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Moyamoya Disease Moyamoya disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 23054610, 30829272
Breast Neoplasms Inhibit 28393246
Carcinoma Non Small Cell Lung Associate 34528912
Cerulean cataract Associate 18626973
Lung Neoplasms Inhibit 28393246
Motor Neuron Disease Associate 35468848
Muscle Weakness Associate 20458068
Muscular Dystrophies Limb Girdle Associate 23219351, 25849006, 37688281
Muscular Dystrophy Duchenne Associate 38057384
Myasthenic Syndromes Congenital Associate 20458068, 20562457, 23219351, 24183479, 25849006, 26501342, 28024842, 36308527, 36579833, 37721175