Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	285349
Gene name	Zinc finger protein 660
Gene symbol	ZNF660
Synonyms (NCBI Gene)	-
Chromosome	3
Chromosome location	3p21.31
Summary	This gene encodes a protein that contains multiple C2H2 zinc finger domains, and is located in a cluster of zinc-finger encoding genes on chromosome 3. Naturally-occurring readthrough transcription is observed between this gene and the downstream zinc fin

Show/Hide all (52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017186	hsa-miR-335-5p	Microarray	18185580
MIRT647570	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT647569	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT647568	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT647567	hsa-miR-539-5p	HITS-CLIP	23824327
MIRT647565	hsa-miR-4448	HITS-CLIP	23824327
MIRT647566	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT647564	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT647563	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT647570	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT647569	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT647568	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT647567	hsa-miR-539-5p	HITS-CLIP	23824327
MIRT647565	hsa-miR-4448	HITS-CLIP	23824327
MIRT647566	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT647564	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT647563	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT1534078	hsa-miR-1246	CLIP-seq
MIRT1534079	hsa-miR-15a	CLIP-seq
MIRT1534080	hsa-miR-15b	CLIP-seq
MIRT1534081	hsa-miR-16	CLIP-seq
MIRT1534082	hsa-miR-188-5p	CLIP-seq
MIRT1534083	hsa-miR-1915	CLIP-seq
MIRT1534084	hsa-miR-195	CLIP-seq
MIRT1534085	hsa-miR-204	CLIP-seq
MIRT1534086	hsa-miR-211	CLIP-seq
MIRT1534087	hsa-miR-3153	CLIP-seq
MIRT1534088	hsa-miR-3158-3p	CLIP-seq
MIRT1534089	hsa-miR-3173-3p	CLIP-seq
MIRT1534090	hsa-miR-3667-3p	CLIP-seq
MIRT1534091	hsa-miR-424	CLIP-seq
MIRT1534092	hsa-miR-4274	CLIP-seq
MIRT1534093	hsa-miR-4318	CLIP-seq
MIRT1534094	hsa-miR-4648	CLIP-seq
MIRT1534095	hsa-miR-4654	CLIP-seq
MIRT1534096	hsa-miR-4668-5p	CLIP-seq
MIRT1534097	hsa-miR-4685-5p	CLIP-seq
MIRT1534098	hsa-miR-4690-3p	CLIP-seq
MIRT1534099	hsa-miR-4726-3p	CLIP-seq
MIRT1534100	hsa-miR-4769-5p	CLIP-seq
MIRT1534101	hsa-miR-4779	CLIP-seq
MIRT1534102	hsa-miR-4795-3p	CLIP-seq
MIRT1534103	hsa-miR-497	CLIP-seq
MIRT1534104	hsa-miR-520a-5p	CLIP-seq
MIRT1534105	hsa-miR-525-5p	CLIP-seq
MIRT1534106	hsa-miR-548a-3p	CLIP-seq
MIRT1534107	hsa-miR-548e	CLIP-seq
MIRT1534108	hsa-miR-548f	CLIP-seq
MIRT1534109	hsa-miR-549	CLIP-seq
MIRT1534110	hsa-miR-618	CLIP-seq
MIRT1534111	hsa-miR-653	CLIP-seq
MIRT2161544	hsa-miR-3682-5p	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6AZW8

Protein name

Zinc finger protein 660

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	50 → 72	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	78 → 100	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	106 → 128	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	134 → 156	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	162 → 184	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	218 → 240	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	246 → 268	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	274 → 296	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	302 → 324	Zinc finger, C2H2 type	Domain

Sequence

MRRKTRNFKHKTVKDNKVLTEGSDQESEKDNSQCCDPATNERVQAEKRQYVCTECGKAFS
QSANLTVHERIHTGEKPYKCKECGKAFSHSSNLVVHRRIHTGLKPYTCSECGKSFSGKSH
LIRHQGIHSGEKTYECKECGKAFSRSSGLISHHRVHTGEKPYSCIECGKAFSRSSNLTQH
QRMHRGKKVYKCKECGKTCGSNTKIMDHQRIHTGEKPYECDECGKTFILRKTLNEHQRLH
RREKPYKCNECGKAFTSNRNLVDHQRVHTGEKPYKCNECGKTFRQTSQVILHLRTHTKEK
PYKCSECGKAYRYSSQLIQHQRKHNEEKETS

Sequence length

331

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Neoplasms	Associate	29465788	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	29465788	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF660 (zinc finger protein 660)