RABL3 (RAB, member of RAS oncogene family like 3)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
285282
Gene name Gene Name - the full gene name approved by the HGNC.
RAB, member of RAS oncogene family like 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RABL3
Synonyms (NCBI Gene) Gene synonyms aliases
PNCA5
Disease Acronyms (UniProt) Disease acronyms from UniProt database
PNCA5
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q13.33
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
SNP ID Visualize variation Clinical significance Consequence
rs200612497 G>T Risk-factor Coding sequence variant, non coding transcript variant, stop gained
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(736)
miRTarBase ID miRNA Experiments Reference
MIRT029456 hsa-miR-26b-5p Microarray 19088304
MIRT612626 hsa-miR-362-3p HITS-CLIP 19536157
MIRT612625 hsa-miR-329-3p HITS-CLIP 19536157
MIRT612624 hsa-miR-8485 HITS-CLIP 19536157
MIRT612623 hsa-miR-6729-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0001779 Process Natural killer cell differentiation ISS
GO:0003924 Function GTPase activity IBA 21873635
GO:0005515 Function Protein binding IPI 31406347
GO:0005525 Function GTP binding ISS
GO:0006886 Process Intracellular protein transport IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
618542 18072 ENSG00000144840
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q5HYI8
Protein name Rab-like protein 3
Protein function Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function (By
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08477 Roc 8 → 132 Domain
Sequence 
MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTY
YIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVP
TGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTRTAFLAEDFNPEEINLDC
TNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYD
Sequence length 236
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Pancreatic cancer Malignant neoplasm of pancreas rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431 31406347
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Pancreatic Carcinoma familial pancreatic carcinoma GenCC
Show/Hide Text Mining Associations (10)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Stimulate 28443498
Carcinoma Non Small Cell Lung Associate 27164297
Lung Neoplasms Stimulate 27164297
Lymphatic Metastasis Stimulate 28443498
Mouth Neoplasms Associate 31748878
Neoplasms Associate 28443498
Neoplasms Stimulate 31748878
Pancreatic Neoplasms Stimulate 33724601
Squamous Cell Carcinoma of Head and Neck Associate 31748878
Thrombosis Stimulate 28443498