TRDC (T cell receptor delta constant)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
28526
Gene name Gene Name - the full gene name approved by the HGNC.
T cell receptor delta constant
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRDC
Synonyms (NCBI Gene) Gene synonyms aliases
TCRD
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
T cell receptors recognize foreign antigens which have been processed as small peptides and bound to major histocompatibility complex (MHC) molecules at the surface of antigen presenting cells (APC). Each T cell receptor is a dimer consisting of one alpha
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT018594 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0003823 Function Antigen binding IBA 21873635
GO:0006910 Process Phagocytosis, recognition IBA 21873635
GO:0006911 Process Phagocytosis, engulfment IBA 21873635
GO:0006958 Process Complement activation, classical pathway IBA 21873635
GO:0009897 Component External side of plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
186810 12253 TRDC
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID B7Z8K6
Protein name T cell receptor delta constant
Protein function Constant region of T cell receptor (TR) delta chain that participates in the antigen recognition (PubMed:24600447). Gamma-delta TRs recognize a variety of self and foreign non-peptide antigens frequently expressed at the epithelial boundaries be
PDB 1HXM , 8JBV , 8JC0 , 8JCB , 8WXE , 8WY0 , 8WYI , 8YC0 , 9CI8 , 9CIA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07654 C1-set 2 → 78 Immunoglobulin C1-set domain Domain
Sequence 
SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKL
GKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTE
KVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL
Sequence length 153
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Neuroblastoma Neuroblastoma rs113994087, rs113994089, rs281864719, rs863225285, rs863225284, rs863225283, rs281864720, rs863225282, rs863225281, rs1057519698, rs915983602, rs1469271544 19536264
Show/Hide Text Mining Associations (10)
Associations from Text Mining
Disease Name Relationship Type References
Colonic Neoplasms Associate 33140821
Leukemia Associate 16081821, 24769317
Leukemia Large Granular Lymphocytic Associate 18474096
Leukemia T Cell Associate 11380467
Neoplasm Residual Associate 19043668
Precursor B Cell Lymphoblastic Leukemia Lymphoma Inhibit 14656882
Precursor B Cell Lymphoblastic Leukemia Lymphoma Associate 19043668
Precursor Cell Lymphoblastic Leukemia Lymphoma Associate 10361104, 19801787
Precursor Cell Lymphoblastic Leukemia Lymphoma Inhibit 14656882
Precursor T Cell Lymphoblastic Leukemia Lymphoma Associate 11380467, 17133429