TRDC (T cell receptor delta constant)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 28526
Gene name T cell receptor delta constant
Gene symbol TRDC
Synonyms (NCBI Gene)
TCRD
Chromosome 14
Chromosome location 14q11.2
Summary T cell receptors recognize foreign antigens which have been processed as small peptides and bound to major histocompatibility complex (MHC) molecules at the surface of antigen presenting cells (APC). Each T cell receptor is a dimer consisting of one alpha
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT018594 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002250 Process Adaptive immune response NAS 30976362
GO:0002376 Process Immune system process IEA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane NAS 30976362
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
186810 12253 TRDC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
B7Z8K6
Protein name T cell receptor delta constant
Protein function Constant region of T cell receptor (TR) delta chain that participates in the antigen recognition (PubMed:24600447). Gamma-delta TRs recognize a variety of self and foreign non-peptide antigens frequently expressed at the epithelial boundaries be
PDB 1HXM , 8JBV , 8JC0 , 8JCB , 8WXE , 8WY0 , 8WYI , 8YC0 , 9CI8 , 9CIA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07654 C1-set 2 → 78 Immunoglobulin C1-set domain Domain
Sequence 
SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKL
GKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTE
KVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL
Sequence length 153
Interactions View interactions