HTR3E (5-hydroxytryptamine receptor 3E)

Gene

• Entrez ID: 285242
• Gene name: 5-hydroxytryptamine receptor 3E
• Gene symbol: HTR3E
• Synonyms (NCBI Gene): 5-HT3-E, 5-HT3E, 5-HT3c1
• Chromosome: 3
• Chromosome location: 3q27.1
• Summary: This locus encodes a 5-hydroxytryptamine (serotonin) receptor subunit. The encoded protein, subunit E, may play a role in neurotransmission in myenteric neurons. Genes encoding subunits C, D and E form a cluster on chromosome 3. Alternatively spliced tran

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001979	hsa-miR-510-5p	Luciferase reporter assay	18614545
MIRT001979	hsa-miR-510-5p	Luciferase reporter assay	18614545
MIRT001979	hsa-miR-510-5p	Luciferase reporter assay	18614545
MIRT1057271	hsa-miR-1184	CLIP-seq
MIRT1057272	hsa-miR-1205	CLIP-seq
MIRT1057273	hsa-miR-298	CLIP-seq
MIRT1057274	hsa-miR-3158-5p	CLIP-seq
MIRT1057275	hsa-miR-944	CLIP-seq
MIRT2245373	hsa-miR-1263	CLIP-seq
MIRT2245374	hsa-miR-3664-3p	CLIP-seq
MIRT2245375	hsa-miR-4259	CLIP-seq
MIRT2245376	hsa-miR-4715-5p	CLIP-seq
MIRT2245377	hsa-miR-510	CLIP-seq
MIRT2245378	hsa-miR-512-5p	CLIP-seq
MIRT2245379	hsa-miR-873	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005231	Function	Excitatory extracellular ligand-gated monoatomic ion channel activity	IBA
GO:0005515	Function	Protein binding	IPI	17392525
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	17392525
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007210	Process	Serotonin receptor signaling pathway	IDA	17392525
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0016020	Component	Membrane	IEA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IBA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IDA	17392525
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0042391	Process	Regulation of membrane potential	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	IDA	17392525
GO:0098662	Process	Inorganic cation transmembrane transport	IEA
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IBA
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IDA	17392525
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IEA
GO:1902495	Component	Transmembrane transporter complex	IBA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IBA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IEA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IPI	17392525

Other IDs

• MIM: 610123
• HGNC: 24005
• e!Ensembl: ENSG00000186038

Protein

• UniProt ID: A5X5Y0
• Protein name: 5-hydroxytryptamine receptor 3E (5-HT3-E) (5-HT3E) (Serotonin receptor 3E)
• Protein function: Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02931	Neur_chan_LBD	43 → 247	Neurotransmitter-gated ion-channel ligand binding domain	Family
  PF02932	Neur_chan_memb	254 → 428	Neurotransmitter-gated ion-channel transmembrane region	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in adult colon and intestine. {ECO:0000269|PubMed:12801637, ECO:0000269|PubMed:14597179}.
• Sequence:

  MEGSWFHRKRFSFYLLLGFLLQGRGVTFTINCSGFGQHGADPTALNSVFNRKPFRPVTNI
  SVPTQVNISFAMSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNL
  WLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTF
  SSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRGGNLYDQIVFY
  VAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLL
  PTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRC
  CPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHS
  VELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT

• Sequence length: 456

Pathways

KEGG:

Serotonergic synapse
Taste transduction

Reactome:

Neurotransmitter receptors and postsynaptic signal transmission