Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	285242
Gene name Gene Name - the full gene name approved by the HGNC.	5-hydroxytryptamine receptor 3E
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HTR3E
Synonyms (NCBI Gene) Gene synonyms aliases	5-HT3-E, 5-HT3E, 5-HT3c1
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q27.1
Summary Summary of gene provided in NCBI Entrez Gene.	This locus encodes a 5-hydroxytryptamine (serotonin) receptor subunit. The encoded protein, subunit E, may play a role in neurotransmission in myenteric neurons. Genes encoding subunits C, D and E form a cluster on chromosome 3. Alternatively spliced tran

Show/Hide all(15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001979	hsa-miR-510-5p	Luciferase reporter assay	18614545
MIRT001979	hsa-miR-510-5p	Luciferase reporter assay	18614545
MIRT001979	hsa-miR-510-5p	Luciferase reporter assay	18614545
MIRT1057271	hsa-miR-1184	CLIP-seq
MIRT1057272	hsa-miR-1205	CLIP-seq
MIRT1057273	hsa-miR-298	CLIP-seq
MIRT1057274	hsa-miR-3158-5p	CLIP-seq
MIRT1057275	hsa-miR-944	CLIP-seq
MIRT2245373	hsa-miR-1263	CLIP-seq
MIRT2245374	hsa-miR-3664-3p	CLIP-seq
MIRT2245375	hsa-miR-4259	CLIP-seq
MIRT2245376	hsa-miR-4715-5p	CLIP-seq
MIRT2245377	hsa-miR-510	CLIP-seq
MIRT2245378	hsa-miR-512-5p	CLIP-seq
MIRT2245379	hsa-miR-873	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007210	Process	Serotonin receptor signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	TAS
GO:0022850	Function	Serotonin-gated cation-selective channel activity	IBA	21873635
GO:0022850	Function	Serotonin-gated cation-selective channel activity	IDA	17392525
GO:0030594	Function	Neurotransmitter receptor activity	IBA	21873635
GO:0034220	Process	Ion transmembrane transport	IBA	21873635
GO:0042391	Process	Regulation of membrane potential	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0045202	Component	Synapse	IBA	21873635
GO:0050877	Process	Nervous system process	IBA	21873635

MIM	HGNC	e!Ensembl
610123	24005	ENSG00000186038

Protein

UniProt ID

A5X5Y0

Protein name

5-hydroxytryptamine receptor 3E (5-HT3-E) (5-HT3E) (Serotonin receptor 3E)

Protein function

Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	43 → 247	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	254 → 428	Neurotransmitter-gated ion-channel transmembrane region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in adult colon and intestine. {ECO:0000269|PubMed:12801637, ECO:0000269|PubMed:14597179}.

Sequence

MEGSWFHRKRFSFYLLLGFLLQGRGVTFTINCSGFGQHGADPTALNSVFNRKPFRPVTNI
SVPTQVNISFAMSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNL
WLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTF
SSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRGGNLYDQIVFY
VAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLL
PTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRC
CPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHS
VELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT

Sequence length

456

Interactions

View interactions

	KEGG		Reactome
	Serotonergic synapse Taste transduction		Neurotransmitter receptors and postsynaptic signal transmission

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	19794330

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Dyspepsia	Associate	21192076
Irritable Bowel Syndrome	Associate	21192076

HTR3E (5-hydroxytryptamine receptor 3E)