Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
285203
Gene name Gene Name - the full gene name approved by the HGNC.
EGF domain specific O-linked N-acetylglucosamine transferase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EOGT
Synonyms (NCBI Gene) Gene synonyms aliases
AER61, AOS4, C3orf64, EOGT1
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p14.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an enzyme that acts in the lumen of the endoplasmic reticulum to catalyze the transfer of N-acetylglucosamine to serine or threonine residues of extracellular-targeted proteins. This enzyme modifies proteins containing eukaryotic growth
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs185181819 C>T Pathogenic Splice acceptor variant, genic downstream transcript variant
rs369583084 C>A Pathogenic Genic upstream transcript variant, splice donor variant
rs587776993 C>G Pathogenic 5 prime UTR variant, missense variant, coding sequence variant, non coding transcript variant, genic upstream transcript variant
rs587776994 T>- Pathogenic, likely-pathogenic Coding sequence variant, non coding transcript variant, frameshift variant, intron variant, genic downstream transcript variant
rs587776995 C>T Pathogenic Missense variant, genic downstream transcript variant, coding sequence variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020654 hsa-miR-155-5p Proteomics 18668040
MIRT021350 hsa-miR-9-5p Microarray 17612493
MIRT021748 hsa-miR-132-3p Microarray 17612493
MIRT022493 hsa-miR-124-3p Microarray 18668037
MIRT026413 hsa-miR-192-5p Microarray 19074876
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005788 Component Endoplasmic reticulum lumen IBA
GO:0005788 Component Endoplasmic reticulum lumen IEA
GO:0006493 Process Protein O-linked glycosylation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614789 28526 ENSG00000163378
Protein
UniProt ID Q5NDL2
Protein name EGF domain-specific O-linked N-acetylglucosamine transferase (EC 2.4.1.255) (Extracellular O-linked N-acetylglucosamine transferase)
Protein function Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in extracellular proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc). Specifically glycosylates the Th
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04577 DUF563 245 472 Protein of unknown function (DUF563) Family
Sequence
MLMLFVFGVLLHEVSLSGQNEAPPNTHSIPGEPLYNYASIRLPEEHIPFFLHNNRHIATV
CRKDSLCPYKKHLEKLKYCWGYEKSCKPEFRFGYPVCSYVDMGWTDTLESAEDIFWKQAD
FGYARERLEEMHVLCQPKETSDSSLVCSRYLQYCRATNLYLDLRNIKRNHDRFKEDFFQS
GEIGGHCKLDIRTLTSEGQRKSPLQSWFAELQSYTQLNFRPIEDAKCDIVIEKPTYFMKL
DAGVNMYHHFCDFINLYITQHVNNSFSTDVYIVMWDTSSYGYGDLFSDTWNAFTDYDVIH
LKTYDSKRVCFKEAVFSLLPRMRYGLFYNTPLISGCQNTGLFRAFAQHVLHRLNITQEGP
KDGKIRVTILARSTEYRKILNQNELVNALKTVSTFEVQIVDYKYRELGFLDQLRITHNTD
IFIGMHGAGLTHLLFLPDWAAVFELYNCEDERCYLDLARLRGVHYITWRRQN
KVFPQDKG
HHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL
Sequence length 527
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Other types of O-glycan biosynthesis  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Adams-Oliver Syndrome adams-oliver syndrome, adams-oliver syndrome 4 rs587776994, rs587776995, rs185181819, rs1247059195, rs369583084, rs771160630, rs1559604548, rs587776993 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adams Oliver syndrome Associate 23522784, 23860037, 26299364, 29924900, 36059114
Blister Associate 23522784
Carcinoma Hepatocellular Associate 35069551
Carcinoma Pancreatic Ductal Associate 33562410
Carcinoma Squamous Cell Associate 36059114
Ectodermal Dysplasia Associate 36059114
Hepatitis Autoimmune Associate 35069551
Neoplasms Associate 35069551
Pancreatic Neoplasms Associate 33562410