Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	2852
Gene name	G protein-coupled estrogen receptor 1
Gene symbol	GPER1
Synonyms (NCBI Gene)	CEPRCMKRL2DRY12FEG-1GPCR-BrGPERGPR30LERGULERGU2LyGPRmER
Chromosome	7
Chromosome location	7p22.3
Summary	This gene encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum and a member of the G-protein coupled receptor 1 family. This receptor binds estrogen and activates multiple downstream signaling pathways, leading to stimulation

Show/Hide all (1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT736810	hsa-miR-195-5p	Luciferase reporter assayWestern blottingqRT-PCR	31545414

141

Show/Hide all (141)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	20551055, 21427217
GO:0001934	Process	Positive regulation of protein phosphorylation	ISS
GO:0001956	Process	Positive regulation of neurotransmitter secretion	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002695	Process	Negative regulation of leukocyte activation	IDA	23285008
GO:0003682	Function	Chromatin binding	IDA	20551055
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	8920907
GO:0005496	Function	Steroid binding	IDA	15539556, 15705806
GO:0005515	Function	Protein binding	IPI	20551055, 21149639, 23674134
GO:0005634	Component	Nucleus	IDA	20551055, 23285008
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	15705806
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	21540189
GO:0005769	Component	Early endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	15705806, 21540189
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	15705806
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	21540189
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	15705806
GO:0005886	Component	Plasma membrane	IDA	15539556, 19931550, 21149639, 21427217, 21540189, 23674134
GO:0005886	Component	Plasma membrane	TAS	8920907
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IMP	23840305
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8920907
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	15539556
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	20551055
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0010628	Process	Positive regulation of gene expression	IMP	23840305
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IMP	23840305
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010948	Process	Negative regulation of cell cycle process	IMP	23840305
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0016020	Component	Membrane	IEA
GO:0019228	Process	Neuronal action potential	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0030263	Process	Apoptotic chromosome condensation	ISS
GO:0030264	Process	Nuclear fragmentation involved in apoptotic nuclear change	ISS
GO:0030284	Function	Nuclear estrogen receptor activity	IBA
GO:0030284	Function	Nuclear estrogen receptor activity	IDA	15539556, 15705806
GO:0030284	Function	Nuclear estrogen receptor activity	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	20551055
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IBA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IDA	15705806
GO:0030659	Component	Cytoplasmic vesicle membrane	IDA	21540189
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0031966	Component	Mitochondrial membrane	ISS
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032024	Process	Positive regulation of insulin secretion	ISS
GO:0032591	Component	Dendritic spine membrane	ISS
GO:0032962	Process	Positive regulation of inositol trisphosphate biosynthetic process	IDA	15705806
GO:0038054	Function	G protein-coupled estrogen receptor activity	ISS
GO:0042311	Process	Vasodilation	ISS
GO:0042734	Component	Presynaptic membrane	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	ISS
GO:0043198	Component	Dendritic shaft	ISS
GO:0043401	Process	Steroid hormone receptor signaling pathway	IDA	19931550
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0043679	Component	Axon terminus	ISS
GO:0044327	Component	Dendritic spine head	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045095	Component	Keratin filament	IDA	21149639
GO:0045202	Component	Synapse	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IDA	15705806
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IEA
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IDA	15539556
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20551055
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	21540189
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048786	Component	Presynaptic active zone	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IDA	23285008
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0050769	Process	Positive regulation of neurogenesis	ISS
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051050	Process	Positive regulation of transport	IEA
GO:0051055	Process	Negative regulation of lipid biosynthetic process	IEA
GO:0051055	Process	Negative regulation of lipid biosynthetic process	ISS
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	15705806
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	ISS
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	15705806
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	23840305
GO:0055037	Component	Recycling endosome	IDA	21540189
GO:0055037	Component	Recycling endosome	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IMP	23840305
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	20551055, 21427217
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070474	Process	Positive regulation of uterine smooth muscle contraction	IDA	21427217
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	ISS
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	23285008
GO:0071375	Process	Cellular response to peptide hormone stimulus	IDA	21427217
GO:0071389	Process	Cellular response to mineralocorticoid stimulus	ISS
GO:0071392	Process	Cellular response to estradiol stimulus	IBA
GO:0071392	Process	Cellular response to estradiol stimulus	IDA	15539556, 15705806, 19931550, 20551055, 21149639, 21427217, 21540189, 23285008
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	ISS
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IDA	23674134
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IMP	23840305
GO:1990239	Function	Steroid hormone binding	IDA	19931550
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	ISS
GO:2000724	Process	Positive regulation of cardiac vascular smooth muscle cell differentiation	IMP	23840305
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	ISS

MIM	HGNC	e!Ensembl
601805	4485	ENSG00000164850

Q99527

Protein name

G-protein coupled estrogen receptor 1 (Chemoattractant receptor-like 2) (Flow-induced endothelial G-protein coupled receptor 1) (FEG-1) (G protein-coupled estrogen receptor 1) (G-protein coupled receptor 30) (GPCR-Br) (IL8-related receptor DRY12) (Lymphoc

Protein function

G-protein coupled estrogen receptor that binds to 17-beta-estradiol (E2) with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways. Stimulates cAMP production, calcium mobilization and tyrosine ki

PDB

8XOF , 8XOG , 8XOH , 8XOI , 8XOJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	76 → 324	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in placenta, endothelial and epithelial cells, non laboring and laboring term myometrium, fibroblasts and cancer-associated fibroblasts (CAF), prostate cancer cells and invasive adenocarcinoma (at protein level). Ubiquitously

Sequence

MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLF
LSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLH
ERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGL
IWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRV
LVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRH
AHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVI
PDSTEQSDVRFSSAV

Sequence length

375

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance Hormone signaling Estrogen signaling pathway GnRH secretion		Peptide ligand-binding receptors G alpha (i) signalling events

GPER1 (G protein-coupled estrogen receptor 1)