Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
28514
Gene name Gene Name - the full gene name approved by the HGNC.
Delta like canonical Notch ligand 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DLL1
Synonyms (NCBI Gene) Gene synonyms aliases
DELTA1, DL1, Delta, NEDBAS
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q27
Summary Summary of gene provided in NCBI Entrez Gene.
DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. [provided by RefSeq, Jul 2008]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs371262985 C>A,T Pathogenic Missense variant, stop gained, coding sequence variant, intron variant
rs1583151308 CT>- Pathogenic Intron variant, coding sequence variant, frameshift variant
rs1583152162 G>A Pathogenic Intron variant, coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001757 hsa-miR-34a-5p Review, Luciferase reporter assay 19461653
MIRT001757 hsa-miR-34a-5p Review, Luciferase reporter assay 19461653
MIRT004584 hsa-miR-1-3p Review 20140609
MIRT001757 hsa-miR-34a-5p Luciferase reporter assay 20144220
MIRT001757 hsa-miR-34a-5p Luciferase reporter assay 14697198
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001709 Process Cell fate determination NAS 11581320
GO:0001756 Process Somitogenesis IEA
GO:0001756 Process Somitogenesis ISS
GO:0001757 Process Somite specification IEA
GO:0001947 Process Heart looping IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606582 2908 ENSG00000198719
Protein
UniProt ID O00548
Protein name Delta-like protein 1 (Drosophila Delta homolog 1) (Delta1) (H-Delta-1)
Protein function Transmembrane ligand protein of NOTCH1, NOTCH2 and NOTCH3 receptors that binds the extracellular domain (ECD) of Notch receptor in a cis and trans fashion manner (PubMed:11006133). Following transinteraction, ligand cells produce mechanical forc
PDB 4XBM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07657 MNNL 22 92 N terminus of Notch ligand Family
PF01414 DSL 159 221 Delta serrate ligand Domain
PF00008 EGF 285 324 EGF-like domain Domain
PF00008 EGF 332 361 EGF-like domain Domain
PF00008 EGF 370 399 EGF-like domain Domain
PF00008 EGF 409 439 EGF-like domain Domain
PF00008 EGF 447 477 EGF-like domain Domain
PF12661 hEGF 490 511 Human growth factor-like EGF Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart and pancreas, with lower expression in brain and muscle and almost no expression in placenta, lung, liver and kidney.
Sequence
MGSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGVDSF
SLPDGGGADSAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYC
TEPICLPGCDEQHGFCDKP
GECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN
GATCTNTGQGSYTCSCRPGYTGAT
CELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYG
K
ICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKC
VDLGDAYLCRCQAGFSGRH
CDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHERGHRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQG
GPFPWVAVCAGVILVLMLLLGCAAVVVCVRLRLQKHRPPADPCRGETETMNNLANCQREK
DISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSK
RDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKDECVIA
TEV
Sequence length 723
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocrine resistance
Notch signaling pathway
Th1 and Th2 cell differentiation
Pathways in cancer
Chemical carcinogenesis - receptor activation
Breast cancer
  Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 t(7;9)(NOTCH1:M1580_K2555) Translocation Mutant
Constitutive Signaling by NOTCH1 HD Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
NOTCH3 Activation and Transmission of Signal to the Nucleus
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Holoprosencephaly Holoprosencephaly sequence N/A N/A ClinVar
Non-Syndromic Intellectual Disability autosomal dominant non-syndromic intellectual disability N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 27196489
Adenoma Stimulate 25487926
Adenomatous Polyposis Coli Associate 25487926
Anemia Aplastic Associate 37980558
Aortic Aneurysm Thoracic Associate 23300792
Arthritis Rheumatoid Associate 37796367
Autism Spectrum Disorder Associate 28018572, 31353024
Barrett Esophagus Associate 26568294
Breast Neoplasms Associate 18681966, 31107884
Breast Neoplasms Inhibit 36008793