Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	28512
Gene name	NFKB inhibitor interacting Ras like 1
Gene symbol	NKIRAS1
Synonyms (NCBI Gene)	KBRAS1kappaB-Ras1
Chromosome	3
Chromosome location	3p24.2

152

Show/Hide all (152)

miRTarBase ID	miRNA	Experiments	Reference
MIRT571870	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT571869	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT571868	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT571867	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT571866	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT571865	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT571864	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT571863	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT571861	hsa-miR-3609	PAR-CLIP	20371350
MIRT571862	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT571860	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT571859	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT571858	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT571857	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT571856	hsa-miR-4744	PAR-CLIP	20371350
MIRT571855	hsa-miR-4509	PAR-CLIP	20371350
MIRT571854	hsa-miR-617	PAR-CLIP	20371350
MIRT571853	hsa-miR-6505-3p	PAR-CLIP	20371350
MIRT571870	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT571869	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT571868	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT571867	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT571866	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT571865	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT571864	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT571863	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT571861	hsa-miR-3609	PAR-CLIP	20371350
MIRT571862	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT571860	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT571859	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT571858	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT571857	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT571856	hsa-miR-4744	PAR-CLIP	20371350
MIRT571855	hsa-miR-4509	PAR-CLIP	20371350
MIRT571854	hsa-miR-617	PAR-CLIP	20371350
MIRT571853	hsa-miR-6505-3p	PAR-CLIP	20371350
MIRT1186240	hsa-miR-106a	CLIP-seq
MIRT1186241	hsa-miR-106b	CLIP-seq
MIRT1186242	hsa-miR-1263	CLIP-seq
MIRT1186243	hsa-miR-141	CLIP-seq
MIRT1186244	hsa-miR-17	CLIP-seq
MIRT1186245	hsa-miR-200a	CLIP-seq
MIRT1186246	hsa-miR-20a	CLIP-seq
MIRT1186247	hsa-miR-20b	CLIP-seq
MIRT1186248	hsa-miR-27a	CLIP-seq
MIRT1186249	hsa-miR-27b	CLIP-seq
MIRT1186250	hsa-miR-3143	CLIP-seq
MIRT1186251	hsa-miR-3145-5p	CLIP-seq
MIRT1186252	hsa-miR-34b	CLIP-seq
MIRT1186253	hsa-miR-34c-3p	CLIP-seq
MIRT1186254	hsa-miR-421	CLIP-seq
MIRT1186255	hsa-miR-4272	CLIP-seq
MIRT1186256	hsa-miR-4484	CLIP-seq
MIRT1186257	hsa-miR-4705	CLIP-seq
MIRT1186258	hsa-miR-4716-5p	CLIP-seq
MIRT1186259	hsa-miR-4777-3p	CLIP-seq
MIRT1186260	hsa-miR-508-5p	CLIP-seq
MIRT1186261	hsa-miR-513a-5p	CLIP-seq
MIRT1186262	hsa-miR-519a	CLIP-seq
MIRT1186263	hsa-miR-519d	CLIP-seq
MIRT1186264	hsa-miR-548ah	CLIP-seq
MIRT1186265	hsa-miR-548an	CLIP-seq
MIRT1186266	hsa-miR-568	CLIP-seq
MIRT1186267	hsa-miR-619	CLIP-seq
MIRT1186268	hsa-miR-93	CLIP-seq
MIRT2053967	hsa-miR-1275	CLIP-seq
MIRT2053968	hsa-miR-153	CLIP-seq
MIRT2053969	hsa-miR-3170	CLIP-seq
MIRT2053970	hsa-miR-4453	CLIP-seq
MIRT2053971	hsa-miR-448	CLIP-seq
MIRT2053972	hsa-miR-4538	CLIP-seq
MIRT2053973	hsa-miR-4665-5p	CLIP-seq
MIRT2283163	hsa-miR-125a-3p	CLIP-seq
MIRT2053967	hsa-miR-1275	CLIP-seq
MIRT1186248	hsa-miR-27a	CLIP-seq
MIRT1186249	hsa-miR-27b	CLIP-seq
MIRT2053969	hsa-miR-3170	CLIP-seq
MIRT2283164	hsa-miR-4271	CLIP-seq
MIRT2053970	hsa-miR-4453	CLIP-seq
MIRT2053972	hsa-miR-4538	CLIP-seq
MIRT2053973	hsa-miR-4665-5p	CLIP-seq
MIRT2283165	hsa-miR-4725-3p	CLIP-seq
MIRT1186261	hsa-miR-513a-5p	CLIP-seq
MIRT1186262	hsa-miR-519a	CLIP-seq
MIRT2283166	hsa-miR-552	CLIP-seq
MIRT2283167	hsa-miR-625	CLIP-seq
MIRT1186252	hsa-miR-34b	CLIP-seq
MIRT1186253	hsa-miR-34c-3p	CLIP-seq
MIRT1186254	hsa-miR-421	CLIP-seq
MIRT1186257	hsa-miR-4705	CLIP-seq
MIRT2581378	hsa-miR-3180-5p	CLIP-seq
MIRT2581379	hsa-miR-3190	CLIP-seq
MIRT1186252	hsa-miR-34b	CLIP-seq
MIRT1186253	hsa-miR-34c-3p	CLIP-seq
MIRT2581380	hsa-miR-3667-3p	CLIP-seq
MIRT1186254	hsa-miR-421	CLIP-seq
MIRT1186255	hsa-miR-4272	CLIP-seq
MIRT1186256	hsa-miR-4484	CLIP-seq
MIRT2581381	hsa-miR-4666-3p	CLIP-seq
MIRT1186257	hsa-miR-4705	CLIP-seq
MIRT2581382	hsa-miR-4752	CLIP-seq
MIRT2581383	hsa-miR-4777-5p	CLIP-seq
MIRT2581384	hsa-miR-518d-5p	CLIP-seq
MIRT2581385	hsa-miR-519b-5p	CLIP-seq
MIRT2581386	hsa-miR-519c-5p	CLIP-seq
MIRT2581387	hsa-miR-520a-5p	CLIP-seq
MIRT2581388	hsa-miR-520c-5p	CLIP-seq
MIRT2581389	hsa-miR-525-5p	CLIP-seq
MIRT2581390	hsa-miR-526a	CLIP-seq
MIRT1186265	hsa-miR-548an	CLIP-seq
MIRT1186266	hsa-miR-568	CLIP-seq
MIRT2686356	hsa-miR-1305	CLIP-seq
MIRT2686357	hsa-miR-302a	CLIP-seq
MIRT2686358	hsa-miR-302b	CLIP-seq
MIRT2686359	hsa-miR-302c	CLIP-seq
MIRT2686360	hsa-miR-302d	CLIP-seq
MIRT2686361	hsa-miR-302e	CLIP-seq
MIRT2581378	hsa-miR-3180-5p	CLIP-seq
MIRT2581379	hsa-miR-3190	CLIP-seq
MIRT2686362	hsa-miR-335	CLIP-seq
MIRT1186252	hsa-miR-34b	CLIP-seq
MIRT1186253	hsa-miR-34c-3p	CLIP-seq
MIRT2581380	hsa-miR-3667-3p	CLIP-seq
MIRT2686363	hsa-miR-372	CLIP-seq
MIRT2686364	hsa-miR-373	CLIP-seq
MIRT1186254	hsa-miR-421	CLIP-seq
MIRT1186255	hsa-miR-4272	CLIP-seq
MIRT1186256	hsa-miR-4484	CLIP-seq
MIRT2581381	hsa-miR-4666-3p	CLIP-seq
MIRT2686365	hsa-miR-4693-5p	CLIP-seq
MIRT1186257	hsa-miR-4705	CLIP-seq
MIRT2581382	hsa-miR-4752	CLIP-seq
MIRT2581383	hsa-miR-4777-5p	CLIP-seq
MIRT2686366	hsa-miR-498	CLIP-seq
MIRT2686367	hsa-miR-515-3p	CLIP-seq
MIRT2581384	hsa-miR-518d-5p	CLIP-seq
MIRT1186262	hsa-miR-519a	CLIP-seq
MIRT2581385	hsa-miR-519b-5p	CLIP-seq
MIRT2581386	hsa-miR-519c-5p	CLIP-seq
MIRT2686368	hsa-miR-519e	CLIP-seq
MIRT2686369	hsa-miR-520a-3p	CLIP-seq
MIRT2581387	hsa-miR-520a-5p	CLIP-seq
MIRT2686370	hsa-miR-520b	CLIP-seq
MIRT2686371	hsa-miR-520c-3p	CLIP-seq
MIRT2581388	hsa-miR-520c-5p	CLIP-seq
MIRT2686372	hsa-miR-520d-3p	CLIP-seq
MIRT2686373	hsa-miR-520e	CLIP-seq
MIRT2581389	hsa-miR-525-5p	CLIP-seq
MIRT2581390	hsa-miR-526a	CLIP-seq
MIRT1186265	hsa-miR-548an	CLIP-seq
MIRT1186266	hsa-miR-568	CLIP-seq
MIRT2686374	hsa-miR-765	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	NAS	10657303
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005829	Component	Cytosol	IDA
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:0032484	Process	Ral protein signal transduction	IBA
GO:0032484	Process	Ral protein signal transduction	IEA
GO:0032794	Function	GTPase activating protein binding	IBA
GO:0032794	Function	GTPase activating protein binding	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	NAS	10657303
GO:0043129	Process	Surfactant homeostasis	IEA
GO:0048286	Process	Lung alveolus development	IEA

MIM	HGNC	e!Ensembl
604496	17899	ENSG00000197885

Q9NYS0

Protein name

NF-kappa-B inhibitor-interacting Ras-like protein 1 (I-kappa-B-interacting Ras-like protein 1) (Kappa B-Ras protein 1) (KappaB-Ras1)

Protein function

Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking pho

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	6 → 170	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10657303}.

Sequence

MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLY
DTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGN
KIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLP
GRKNKGNSNSEN

Sequence length

192

Interactions

View interactions

	Reactome
			RIP-mediated NFkB activation via ZBP1 TAK1 activates NFkB by phosphorylation and activation of IKKs complex TRAF6 mediated NF-kB activation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIAMOND-BLACKFAN ANEMIA 12	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	22491060	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	24977159	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	22491060	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Associate	34929253	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	25869366	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	22491060	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	22491060	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	23202957	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Insufficiency	Associate	35619695	★★★★★ ★☆☆☆☆ Found in Text Mining only

NKIRAS1 (NFKB inhibitor interacting Ras like 1)