STPG4 (sperm-tail PG-rich repeat containing 4)

Gene

• Entrez ID: 285051
• Gene name: Sperm-tail PG-rich repeat containing 4
• Gene symbol: STPG4
• Synonyms (NCBI Gene): C2orf61, GSE
• Chromosome: 2
• Chromosome location: 2p21

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0001674	Component	Female germ cell nucleus	IEA
GO:0001939	Component	Female pronucleus	IBA
GO:0001939	Component	Female pronucleus	IEA
GO:0001939	Component	Female pronucleus	ISS
GO:0001940	Component	Male pronucleus	IBA
GO:0001940	Component	Male pronucleus	IEA
GO:0001940	Component	Male pronucleus	ISS
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006325	Process	Chromatin organization	IEA
GO:0042393	Function	Histone binding	IBA
GO:0042393	Function	Histone binding	IEA
GO:0042585	Component	Germinal vesicle	IBA
GO:0042585	Component	Germinal vesicle	IEA
GO:0042585	Component	Germinal vesicle	ISS
GO:0044727	Process	Epigenetic programing of male pronucleus	IBA
GO:0044727	Process	Epigenetic programing of male pronucleus	IEA
GO:0044727	Process	Epigenetic programing of male pronucleus	ISS
GO:0072529	Process	Pyrimidine-containing compound catabolic process	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q8N801
• Protein name: Protein STPG4 (Gonad-specific expression gene protein) (GSE) (Sperm-tail PG-rich repeat-containing protein 4)
• Protein function: Maternal factor that plays a role in epigenetic chromatin reprogramming during early development of the zygote. Involved in the regulation of gametic DNA demethylation by inducing the conversion of the modified genomic base 5-methylcytosine (5mC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07004	SHIPPO-rpt	176 → 203	Sperm-tail PG-rich repeat	Repeat
  PF07004	SHIPPO-rpt	210 → 239	Sperm-tail PG-rich repeat	Repeat

• Sequence:

  MDQPAVATASTSIREDLVGGESFITASKPAQKTSSFEREGWWRIALTDTPIPGTYHLKTF
  IEESLLNPVIATYNFKNEGRKKPPLVQRNNPVLNDLPQYMPPDFLDLLKKQVATYSFKDK
  PRPSPSTLVDKDQSLQLSPGQYNVLPAPVPKYASRSCVFRSTVQRFPTTYFIPHEGPGPG
  HYNVKMPPTSSVTSCFQSRVPRFLPSCSKTPGPGAYTTLRQFPKQSPTIAKMGQEHSLFF
  NNNNWLLK

• Sequence length: 248