Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID	285016
Gene name	ALK and LTK ligand 2
Gene symbol	ALKAL2
Synonyms (NCBI Gene)	AUGAFAM150BPRO1097RGPG542
Chromosome	2
Chromosome location	2p25.3

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IDA	30061385, 34646012, 34819673
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	26418745
GO:0005576	Component	Extracellular region	IDA	30061385
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	30061385
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IDA	30061385, 34646012
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IDA	30061385, 34646012, 34819673
GO:0010976	Process	Positive regulation of neuron projection development	IDA	26418745, 30061385
GO:0016020	Component	Membrane	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	30061385, 34646012, 34819673
GO:0030298	Function	Receptor signaling protein tyrosine kinase activator activity	IBA
GO:0030298	Function	Receptor signaling protein tyrosine kinase activator activity	IDA	26418745, 30061385, 34646012, 34819673
GO:0030298	Function	Receptor signaling protein tyrosine kinase activator activity	IEA
GO:0030971	Function	Receptor tyrosine kinase binding	IBA
GO:0030971	Function	Receptor tyrosine kinase binding	IDA	26418745
GO:0030971	Function	Receptor tyrosine kinase binding	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	26418745
GO:0070378	Process	Positive regulation of ERK5 cascade	IBA
GO:0070378	Process	Positive regulation of ERK5 cascade	IDA	26418745

MIM	HGNC	e!Ensembl
619671	27683	ENSG00000189292

Q6UX46

Protein name

ALK and LTK ligand 2 (Augmentor alpha) (AUG-alpha)

Protein function

Cytokine that acts as a physiological ligand for receptor tyrosine kinases LTK and ALK, leading to their activation (PubMed:26418745, PubMed:26630010, PubMed:30061385, PubMed:33411331, PubMed:34646012, PubMed:34819673). Cytokine-binding is suffi

PDB

7LS0 , 7MZX , 7N00 , 7NWZ , 9G5I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15129	FAM150	33 → 150	FAM150 family	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in adrenal gland and modest levels in pancreas, testis and uterus. {ECO:0000269|PubMed:25331893}.

Sequence

MRGPGHPLLLGLLLVLGAAGRGRGGAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQ
LLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYH
NTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ

Sequence length

152

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ALKAL2 (ALK and LTK ligand 2)