Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	285
Gene name Gene Name - the full gene name approved by the HGNC.	Angiopoietin 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ANGPT2
Synonyms (NCBI Gene) Gene synonyms aliases	AGPT2, ANG2, LMPHM10
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p23.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the angiopoietin family of growth factors. The protein encoded by this gene is an antagonist of angiopoietin 1, and both angiopoietin 1 and angiopoietin 2 are ligands for the endothelial TEK receptor tyrosine kinase. Angiopoietin 2 is

Show/Hide all(135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438013	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR	24384875
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438090	hsa-miR-542-3p	Luciferase reporter assay, qRT-PCR, Western blot	24403060
MIRT438013	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR	24384875
MIRT732607	hsa-miR-17-3p	qRT-PCR	33909697
MIRT732608	hsa-miR-24-3p	qRT-PCR	33909697
MIRT732615	hsa-miR-214-3p	qRT-PCR	33909697
MIRT732616	hsa-miR-320a	qRT-PCR	33909697
MIRT732651	hsa-miR-205-5p	Immunohistochemistry (IHC), In situ hybridization, Microarray, qRT-PCR, Western blotting	31547870
MIRT781426	hsa-miR-1224-3p	CLIP-seq
MIRT781427	hsa-miR-125a-3p	CLIP-seq
MIRT781428	hsa-miR-1267	CLIP-seq
MIRT781429	hsa-miR-1273f	CLIP-seq
MIRT781430	hsa-miR-1289	CLIP-seq
MIRT781431	hsa-miR-129-5p	CLIP-seq
MIRT781432	hsa-miR-1303	CLIP-seq
MIRT781433	hsa-miR-135a	CLIP-seq
MIRT781434	hsa-miR-135b	CLIP-seq
MIRT781435	hsa-miR-143	CLIP-seq
MIRT781436	hsa-miR-148a	CLIP-seq
MIRT781437	hsa-miR-148b	CLIP-seq
MIRT781438	hsa-miR-152	CLIP-seq
MIRT781439	hsa-miR-1913	CLIP-seq
MIRT781440	hsa-miR-197	CLIP-seq
MIRT781441	hsa-miR-198	CLIP-seq
MIRT781442	hsa-miR-3164	CLIP-seq
MIRT781443	hsa-miR-3194-3p	CLIP-seq
MIRT781444	hsa-miR-3198	CLIP-seq
MIRT781445	hsa-miR-324-3p	CLIP-seq
MIRT781446	hsa-miR-3545-3p	CLIP-seq
MIRT781447	hsa-miR-3662	CLIP-seq
MIRT781448	hsa-miR-3663-5p	CLIP-seq
MIRT781449	hsa-miR-378g	CLIP-seq
MIRT781450	hsa-miR-3934	CLIP-seq
MIRT781451	hsa-miR-4276	CLIP-seq
MIRT781452	hsa-miR-4294	CLIP-seq
MIRT781453	hsa-miR-4309	CLIP-seq
MIRT781454	hsa-miR-431	CLIP-seq
MIRT781455	hsa-miR-4326	CLIP-seq
MIRT781456	hsa-miR-4423-5p	CLIP-seq
MIRT781457	hsa-miR-448	CLIP-seq
MIRT781458	hsa-miR-4527	CLIP-seq
MIRT781459	hsa-miR-4534	CLIP-seq
MIRT781460	hsa-miR-4635	CLIP-seq
MIRT781461	hsa-miR-4645-5p	CLIP-seq
MIRT781462	hsa-miR-4659a-3p	CLIP-seq
MIRT781463	hsa-miR-4659b-3p	CLIP-seq
MIRT781464	hsa-miR-4673	CLIP-seq
MIRT781465	hsa-miR-4680-5p	CLIP-seq
MIRT781466	hsa-miR-4707-5p	CLIP-seq
MIRT781467	hsa-miR-4708-5p	CLIP-seq
MIRT781468	hsa-miR-4716-5p	CLIP-seq
MIRT781469	hsa-miR-4720-3p	CLIP-seq
MIRT781470	hsa-miR-4770	CLIP-seq
MIRT781471	hsa-miR-5096	CLIP-seq
MIRT781472	hsa-miR-764	CLIP-seq
MIRT781473	hsa-miR-924	CLIP-seq
MIRT1930639	hsa-miR-122	CLIP-seq
MIRT1930640	hsa-miR-3135b	CLIP-seq
MIRT1930641	hsa-miR-3150a-3p	CLIP-seq
MIRT1930642	hsa-miR-3175	CLIP-seq
MIRT1930643	hsa-miR-3652	CLIP-seq
MIRT781456	hsa-miR-4423-5p	CLIP-seq
MIRT1930644	hsa-miR-4430	CLIP-seq
MIRT1930645	hsa-miR-4434	CLIP-seq
MIRT1930646	hsa-miR-4466	CLIP-seq
MIRT1930647	hsa-miR-4516	CLIP-seq
MIRT781466	hsa-miR-4707-5p	CLIP-seq
MIRT1930648	hsa-miR-491-5p	CLIP-seq
MIRT1930649	hsa-miR-541	CLIP-seq
MIRT1930650	hsa-miR-598	CLIP-seq
MIRT1930651	hsa-miR-654-5p	CLIP-seq
MIRT1930652	hsa-miR-675	CLIP-seq
MIRT1930653	hsa-miR-939	CLIP-seq
MIRT1930654	hsa-miR-4539	CLIP-seq
MIRT1930655	hsa-miR-4652-3p	CLIP-seq
MIRT1930655	hsa-miR-4652-3p	CLIP-seq
MIRT781469	hsa-miR-4720-3p	CLIP-seq
MIRT2171267	hsa-miR-4775	CLIP-seq
MIRT1930639	hsa-miR-122	CLIP-seq
MIRT781428	hsa-miR-1267	CLIP-seq
MIRT781430	hsa-miR-1289	CLIP-seq
MIRT2171268	hsa-miR-24	CLIP-seq
MIRT1930640	hsa-miR-3135b	CLIP-seq
MIRT781443	hsa-miR-3194-3p	CLIP-seq
MIRT781444	hsa-miR-3198	CLIP-seq
MIRT781446	hsa-miR-3545-3p	CLIP-seq
MIRT1930643	hsa-miR-3652	CLIP-seq
MIRT2171269	hsa-miR-4284	CLIP-seq
MIRT2171270	hsa-miR-4287	CLIP-seq
MIRT781452	hsa-miR-4294	CLIP-seq
MIRT781453	hsa-miR-4309	CLIP-seq
MIRT781454	hsa-miR-431	CLIP-seq
MIRT781456	hsa-miR-4423-5p	CLIP-seq
MIRT1930644	hsa-miR-4430	CLIP-seq
MIRT1930646	hsa-miR-4466	CLIP-seq
MIRT2171271	hsa-miR-4469	CLIP-seq
MIRT781459	hsa-miR-4534	CLIP-seq
MIRT2171272	hsa-miR-4685-3p	CLIP-seq
MIRT781466	hsa-miR-4707-5p	CLIP-seq
MIRT2171273	hsa-miR-4713-5p	CLIP-seq
MIRT2171274	hsa-miR-4740-3p	CLIP-seq
MIRT2171275	hsa-miR-4772-3p	CLIP-seq
MIRT1930652	hsa-miR-675	CLIP-seq
MIRT781473	hsa-miR-924	CLIP-seq
MIRT2473926	hsa-miR-181a	CLIP-seq
MIRT2473927	hsa-miR-181b	CLIP-seq
MIRT2473928	hsa-miR-181c	CLIP-seq
MIRT2473929	hsa-miR-181d	CLIP-seq
MIRT2473930	hsa-miR-27a	CLIP-seq
MIRT2473931	hsa-miR-27b	CLIP-seq
MIRT2473932	hsa-miR-3591-3p	CLIP-seq
MIRT2473933	hsa-miR-3617	CLIP-seq
MIRT2473934	hsa-miR-4262	CLIP-seq
MIRT2171270	hsa-miR-4287	CLIP-seq
MIRT781456	hsa-miR-4423-5p	CLIP-seq
MIRT2171271	hsa-miR-4469	CLIP-seq
MIRT2473935	hsa-miR-452	CLIP-seq
MIRT2473936	hsa-miR-4676-3p	CLIP-seq
MIRT2171272	hsa-miR-4685-3p	CLIP-seq
MIRT2171273	hsa-miR-4713-5p	CLIP-seq
MIRT2473937	hsa-miR-513a-5p	CLIP-seq
MIRT2473938	hsa-miR-641	CLIP-seq
MIRT2171270	hsa-miR-4287	CLIP-seq
MIRT2171271	hsa-miR-4469	CLIP-seq
MIRT2473935	hsa-miR-452	CLIP-seq
MIRT2473936	hsa-miR-4676-3p	CLIP-seq
MIRT2171272	hsa-miR-4685-3p	CLIP-seq
MIRT2171273	hsa-miR-4713-5p	CLIP-seq

Transcription factors

Show/Hide all(9)

Transcription factor	Regulation	Reference
ETS1	Activation	15003510
ETS2	Activation	15003510
FOXC2	Unknown	20213583
FOXO1	Unknown	20213583
GATA2	Unknown	22792348
LMO2	Unknown	22792348
LYL1	Unknown	22792348
TAL1	Unknown	22792348
VHL	Repression	12434420

Show/Hide all(44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9204896, 10766762
GO:0005515	Function	Protein binding	IPI	15893672, 16732286, 20708158
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10218485
GO:0005615	Component	Extracellular space	IDA	9660821
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	10766762
GO:0007165	Process	Signal transduction	TAS	10766762
GO:0007281	Process	Germ cell development	IEA
GO:0007596	Process	Blood coagulation	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010467	Process	Gene expression	IDA	28179430
GO:0010812	Process	Negative regulation of cell-substrate adhesion	IEA
GO:0014823	Process	Response to activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030195	Process	Negative regulation of blood coagulation	IDA	10761923
GO:0030195	Process	Negative regulation of blood coagulation	TAS	15005336
GO:0030971	Function	Receptor tyrosine kinase binding	IBA
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	19922791
GO:0031012	Component	Extracellular matrix	IBA
GO:0031100	Process	Animal organ regeneration	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	9660821
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048014	Process	Tie signaling pathway	IBA
GO:0048014	Process	Tie signaling pathway	IDA	19922791
GO:0048018	Function	Receptor ligand activity	IDA	29323190
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0050820	Process	Positive regulation of coagulation	IDA	29323190
GO:0050928	Process	Negative regulation of positive chemotaxis	IDA	9660821
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0072012	Process	Glomerulus vasculature development	IEA
GO:0072012	Process	Glomerulus vasculature development	ISS

MIM	HGNC	e!Ensembl
601922	485	ENSG00000091879

Protein

UniProt ID

O15123

Protein name

Angiopoietin-2 (ANG-2)

Protein function

Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling (PubMed:15284220, PubMed:19116766, PubMed:19223473, PubMed:9204896). Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1 (PubMed:15284

PDB

1Z3S , 1Z3U , 2GY7 , 4JZC , 4ZFG , 8VGP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00147	Fibrinogen_C	280 → 494	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

Sequence

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPY
VSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQ
TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE
INKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVN
NSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTL
TFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFV
SQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPG
NDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGS
GYSLKATTMMIRPADF

Sequence length

496

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway HIF-1 signaling pathway PI3K-Akt signaling pathway Kaposi sarcoma-associated herpesvirus infection		Tie2 Signaling

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Lymphatic Malformation	lymphatic malformation 10	N/A	N/A	GenCC

Show/Hide Text Mining Associations (204)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acidosis	Associate	23383853
Acquired Immunodeficiency Syndrome	Stimulate	15220918
Acute Aortic Syndrome	Associate	36309656
Acute Coronary Syndrome	Stimulate	20847963
Acute Kidney Injury	Associate	32680471
Acute Lung Injury	Associate	19271210, 21257790, 27798093
Adenocarcinoma	Associate	17785951, 25885021
Adenocarcinoma of Lung	Inhibit	22048948
Angina Stable	Associate	36435742
Angina Unstable	Stimulate	23421785
Arthritis Psoriatic	Stimulate	34691360
Arthritis Rheumatoid	Associate	12010571, 21858161, 29843785, 30745815
Atelosteogenesis type 1	Associate	24353325
Atherosclerosis	Associate	26283334, 30688091
Atrial Fibrillation	Associate	34794617
Atypical Squamous Cells of the Cervix	Associate	30043637
Biliary Tract Diseases	Associate	24823366
Blood Loss Surgical	Stimulate	28651907
Blood Loss Surgical	Associate	35585570
Bone Marrow Diseases	Stimulate	32383346
Brain Edema	Associate	34815366
Brain Injuries Traumatic	Associate	31553988
Brain Ischemia	Stimulate	31795484
Breast Neoplasms	Associate	23232696, 25755760, 27353038, 28045923, 28062977, 31619709, 31642813, 34685578, 36008514, 39302921
Bronchopulmonary Dysplasia	Associate	31967847
Carcinogenesis	Associate	11861279, 24404127
Carcinogenesis	Inhibit	15517881
Carcinoma Hepatocellular	Associate	14600132, 14702352, 16830384, 17003480, 24045661, 29604220, 32183816, 32644941, 33647018, 34232180, 35987690, 36157115, 36308081, 37495746, 39746507
Carcinoma Mucoepidermoid	Associate	21948244
Carcinoma Non Small Cell Lung	Associate	24587185, 36907878
Carcinoma Non Small Cell Lung	Stimulate	27589869
Carcinoma Ovarian Epithelial	Associate	33151982, 33173439
Carcinoma Pancreatic Ductal	Associate	37907568
Carcinoma Renal Cell	Associate	17505508, 24384875, 27100185
Carcinoma Squamous Cell	Associate	25885021
Carcinoma Transitional Cell	Associate	15517881
Cardiomegaly	Associate	26801565
Cardiomyopathies	Associate	36435742
Cardiovascular Diseases	Associate	20348331, 23409162
Cartilage Diseases	Associate	16565972
Cell Transformation Neoplastic	Associate	10766762
Cerebrovascular Disorders	Associate	24786777, 34153320
Cholangiocarcinoma	Stimulate	24823366
Colonic Neoplasms	Associate	17785951
Colorectal Neoplasms	Stimulate	22728324
Colorectal Neoplasms	Associate	24574808, 31929743, 33779485
Consciousness Disorders	Associate	24674301
Coronary Artery Disease	Associate	34488330
COVID 19	Associate	32458111, 33317616, 34506304, 35469796, 37956369
Death	Stimulate	19279559, 24040410
Diabetes Gestational	Associate	28112754
Diabetes Mellitus	Associate	20348331, 23106921
Diabetes Mellitus	Stimulate	23421785
Diabetes Mellitus	Inhibit	35932065
Diabetes Mellitus Type 1	Associate	34762787
Diabetes Mellitus Type 2	Associate	35549955
Diabetic Cardiomyopathies	Associate	33909697
Diabetic Nephropathies	Associate	36331122
Diabetic Retinopathy	Stimulate	23106921
Diabetic Retinopathy	Associate	33683746, 34762787
Disease	Associate	35549955
Dyslipidemias	Associate	20348331
Ectodermal Dysplasia	Associate	35628389
Embolism Amniotic Fluid	Associate	19435449
Endometrial Neoplasms	Associate	18644593, 32908897
Endometriosis	Associate	18644593
Endometriosis	Stimulate	19324337
Enterocolitis Necrotizing	Associate	22606320, 34565297
Esophageal Neoplasms	Associate	36569220
Febrile Neutropenia	Associate	20509945
Fetal Growth Retardation	Associate	10854239
Fetal Growth Retardation	Stimulate	34693872
Fever	Associate	20509945
Fibrosis	Inhibit	32582222
Gallbladder Neoplasms	Associate	34036386
Gastrointestinal Stromal Tumors	Associate	17724803
Glioblastoma	Associate	9811337
Glioma	Associate	10506510, 34815366, 37439825, 9811337
Glioma	Stimulate	29846705
Glucose Intolerance	Associate	36055577
Glut1 Deficiency Syndrome	Associate	34565297
Heart Failure	Associate	30557359, 31047008, 31795484, 36435742
Helicobacter Infections	Associate	36877445
Hemangioma	Associate	11733376, 22302773
Hemangioma	Stimulate	19349369
Hemangioma Cavernous Central Nervous System	Stimulate	32556941
Hemangiosarcoma	Associate	10854238, 23558570, 25672915
Hematuria	Associate	33420149
Hemolytic Uremic Syndrome	Associate	23801605
Hemorrhage	Associate	20233519, 23383853, 27354285
Hepatic Veno Occlusive Disease	Associate	26172478
Hepatitis B Chronic	Stimulate	17003480
Hyperglycemia	Stimulate	31828164
Hypertension	Associate	20348331
Hypertension Pulmonary	Associate	26801565, 34326408, 40512521
Hypotrichosis	Associate	37759728
Hypoxia	Associate	12213726
Hypoxia	Stimulate	14702352, 16242072, 26960364, 31340773, 33351148
Hypoxia Brain	Associate	14702352
Idiopathic Interstitial Pneumonias	Associate	27492510
Infarction Anterior Cerebral Artery	Associate	35628389
Infections	Stimulate	36877445
Inflammation	Associate	10766762, 19271210, 26092770, 26283334, 28246376, 33351148, 34565297, 36569220
Inflammation	Stimulate	23409162, 27492510, 31340773
Inflammation	Inhibit	32582222
Intervertebral Disc Degeneration	Associate	28394321
Intestinal Diseases	Associate	34565297
Intracranial Arteriovenous Malformations	Associate	11463715
Ischemia	Associate	20847963
Leiomyoma	Associate	17724803
Leukemia Lymphocytic Chronic B Cell	Associate	20382847, 20670479, 23803577, 25703238, 31585732
Leukemia Myeloid Acute	Associate	24416201, 33284559
Liver Cirrhosis	Associate	29604220
Liver Failure	Associate	33647018
Lung Diseases	Associate	20348277
Lung Neoplasms	Stimulate	23587231
Lung Neoplasms	Associate	36907878
Lupus Erythematosus Systemic	Associate	33420149
Lupus Erythematosus Systemic	Stimulate	33420149, 38162654
Lymphatic Metastasis	Stimulate	17785951
Lymphatic Metastasis	Associate	37684509
Lymphoma B Cell	Associate	23803577
Lymphoma T Cell	Associate	19120365
Macular Degeneration	Inhibit	22312192
Macular Degeneration	Associate	26088137
Macular Edema	Associate	34153320
Malaria	Associate	23383853, 24674301
Malaria	Stimulate	31796023
Malaria Cerebral	Associate	23383853
Malaria Falciparum	Associate	23383853
Mastocytosis	Associate	33687603
Melanoma	Associate	35935946, 37240247
Menorrhagia	Associate	11891175, 19406397
Metabolic Syndrome	Stimulate	20348331
Metabolic Syndrome	Associate	36055577
Migraine Disorders	Associate	28918499
Moyamoya Disease	Associate	36674749
Multiple Myeloma	Associate	24355943
Muscular Atrophy	Associate	23305976
Myocardial Stunning	Stimulate	20847963
Nasal Polyps	Associate	36304979
Neoplasm Metastasis	Associate	11861279, 24292449, 25048347, 25690670, 27100185, 36907878
Neoplasm Metastasis	Stimulate	27353038
Neoplasms	Associate	10506510, 10595926, 10766762, 15112366, 15517881, 15816535, 16614513, 16688775, 17003480, 17327411, 17724803, 17785951, 18632818, 21603628, 22289349 View all (29 more)
Neoplasms	Stimulate	26044849, 27589869
Neoplasms	Inhibit	29843785, 33151982
Neoplasms Adipose Tissue	Associate	36055577
Neoplasms Glandular and Epithelial	Associate	37428914
Neurilemmoma	Associate	17724803
Neuroendocrine Tumors	Associate	27994516
Obesity	Associate	23401397, 36055577
Osteoarthritis	Associate	12010571
Ovarian Neoplasms	Associate	21439064, 31396019, 32878513, 33151982, 33713666, 37684509
Pancreatic Neoplasms	Associate	37907568
Peripheral Arterial Disease	Associate	24157526
Pigmentary Disorder Reticulate with Systemic Manifestations	Associate	23106921
Placenta Diseases	Associate	34693872
Pleural Effusion Malignant	Associate	28401709
Pre Eclampsia	Associate	27405415, 36088594
Pre Eclampsia	Stimulate	34693872
Primary Myelofibrosis	Stimulate	29776986
Prostatic Neoplasms	Associate	30361641
Proteinuria	Associate	33420149
Psoriasis	Stimulate	11348459, 34691360
Pulmonary Disease Chronic Obstructive	Stimulate	23305976
Pulmonary Disease Chronic Obstructive	Associate	26801565, 40512521
Pulmonary Edema	Associate	26590154
Purpura Thrombocytopenic Idiopathic	Stimulate	34326842
Renal Insufficiency Chronic	Stimulate	25049013
Renal Insufficiency Chronic	Inhibit	27846250
Renal Insufficiency Chronic	Associate	30557359, 36331122
Respiratory Distress Syndrome	Associate	19271210, 27492510, 30343317, 33608030, 34556700, 35469796
Respiratory Distress Syndrome	Inhibit	26033126
Respiratory Distress Syndrome	Stimulate	31796023
Respiratory Insufficiency	Associate	34526076
Retinal Vein Occlusion	Associate	25978399
Retinoblastoma	Associate	32329827
Sarcoma Kaposi	Associate	10854238
Sarcoma Kaposi	Stimulate	15220918
Schizophrenia	Associate	39940697
Sepsis	Associate	20509945, 30286031, 30343317, 34153320
Sexual Dysfunction Physiological	Associate	34036386
Shock	Associate	30286031
Shock Septic	Stimulate	20509945
Sleep Apnea Obstructive	Associate	33351148
Sleep Apnea Syndromes	Associate	27798093
Small Cell Lung Carcinoma	Stimulate	26268775
Spinal Cord Injuries	Stimulate	24968203
Squamous Cell Carcinoma of Head and Neck	Associate	24040410
Stomach Neoplasms	Associate	15112366, 16614513, 22449617, 25779598
Thrombosis	Associate	33351148
Thyroid Neoplasms	Stimulate	10595926
Thyroid Nodule	Associate	32689909
Trigeminal Neuralgia	Inhibit	34067581
Tuberculosis Extrapulmonary	Associate	19271210
Urinary Bladder Neoplasms	Associate	15517881
Uterine Cervical Neoplasms	Associate	10766762
Uterine Hemorrhage	Associate	20233519
Vascular Diseases	Associate	23801605, 32680471, 34526076
Vascular Remodeling	Inhibit	32582222
Vascular System Injuries	Associate	33608030, 35469796
Vasculitis	Associate	30352204
Weight Gain	Associate	36055577
Wounds and Injuries	Associate	21257790

ANGPT2 (angiopoietin 2)