Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2847
Gene name Gene Name - the full gene name approved by the HGNC.	Melanin concentrating hormone receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MCHR1
Synonyms (NCBI Gene) Gene synonyms aliases	GPR24, MCH-1R, MCH1R, SLC-1, SLC1
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium

Show/Hide all(32)

miRTarBase ID	miRNA	Experiments
MIRT1137137	hsa-miR-1207-5p	CLIP-seq
MIRT1137138	hsa-miR-1270	CLIP-seq
MIRT1137139	hsa-miR-1293	CLIP-seq
MIRT1137140	hsa-miR-146b-3p	CLIP-seq
MIRT1137141	hsa-miR-1909	CLIP-seq
MIRT1137142	hsa-miR-3173-5p	CLIP-seq
MIRT1137143	hsa-miR-3689d	CLIP-seq
MIRT1137144	hsa-miR-3944-5p	CLIP-seq
MIRT1137145	hsa-miR-432	CLIP-seq
MIRT1137146	hsa-miR-4443	CLIP-seq
MIRT1137147	hsa-miR-4483	CLIP-seq
MIRT1137148	hsa-miR-4683	CLIP-seq
MIRT1137149	hsa-miR-4732-3p	CLIP-seq
MIRT1137150	hsa-miR-4736	CLIP-seq
MIRT1137151	hsa-miR-4763-3p	CLIP-seq
MIRT1137152	hsa-miR-620	CLIP-seq
MIRT1137153	hsa-miR-874	CLIP-seq
MIRT1137154	hsa-miR-890	CLIP-seq
MIRT2039034	hsa-miR-3182	CLIP-seq
MIRT2039035	hsa-miR-4652-3p	CLIP-seq
MIRT2269056	hsa-miR-1178	CLIP-seq
MIRT1137140	hsa-miR-146b-3p	CLIP-seq
MIRT1137142	hsa-miR-3173-5p	CLIP-seq
MIRT1137143	hsa-miR-3689d	CLIP-seq
MIRT1137145	hsa-miR-432	CLIP-seq
MIRT1137146	hsa-miR-4443	CLIP-seq
MIRT1137149	hsa-miR-4732-3p	CLIP-seq
MIRT2269057	hsa-miR-483-3p	CLIP-seq
MIRT2269058	hsa-miR-508-5p	CLIP-seq
MIRT2269059	hsa-miR-766	CLIP-seq
MIRT1137153	hsa-miR-874	CLIP-seq
MIRT1137154	hsa-miR-890	CLIP-seq

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	10421367
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10421367
GO:0005929	Component	Cilium	IDA	28154160
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	10421367
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10421368
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	10421367
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	10421367
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007631	Process	Feeding behavior	TAS	10421367
GO:0008188	Function	Neuropeptide receptor activity	TAS	10860944
GO:0016020	Component	Membrane	IEA
GO:0030273	Function	Melanin-concentrating hormone receptor activity	IEA
GO:0042562	Function	Hormone binding	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	IEA
GO:0051928	Process	Positive regulation of calcium ion transport	IEA
GO:0060170	Component	Ciliary membrane	IEA
GO:0097730	Component	Non-motile cilium	IEA
GO:0097730	Component	Non-motile cilium	ISS

MIM	HGNC	e!Ensembl
601751	4479	ENSG00000128285

Protein

UniProt ID

Q99705

Protein name

Melanin-concentrating hormone receptor 1 (MCH receptor 1) (MCH-R1) (MCHR-1) (G-protein coupled receptor 24) (MCH-1R) (MCH1R) (MCHR) (SLC-1) (Somatostatin receptor-like protein)

Protein function

Receptor for melanin-concentrating hormone, coupled to both G proteins that inhibit adenylyl cyclase and G proteins that activate phosphoinositide hydrolysis.

PDB

8WSS , 8WWH , 8WWI , 8WWJ , 8WWK , 8WWL , 8WWM , 8WWN , 8YNT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	126 → 380	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Highest level in brain, particularly in the frontal cortex and hypothalamus, lower levels in the liver and heart.

Sequence

MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT

Sequence length

422

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling		Peptide ligand-binding receptors G alpha (q) signalling events G alpha (i) signalling events BBSome-mediated cargo-targeting to cilium

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bipolar Disorder	Bipolar disorder	N/A	N/A	GWAS
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Neuroticism	Neuroticism	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Anxiety Disorders	Associate	22921745
Bipolar Disorder	Stimulate	19502010
Bovine Respiratory Disease Complex	Associate	24305679
Carcinoma Renal Cell	Associate	32788609
Colorectal Neoplasms	Associate	39456726
Depressive Disorder Major	Inhibit	16230605
Fibrosis	Associate	34912333
Hyperphagia	Associate	15166293
Neoplasms	Associate	39456726
Obesity	Associate	15166293, 18198296, 20054173, 21637341, 22921745, 24305679, 32329245
Obesity Abdominal	Associate	20054173
Overweight	Associate	24305679
Schizophrenia	Stimulate	19502010
Scleroderma Systemic	Associate	34912333
Thinness	Associate	20833795
Vitiligo	Associate	11927619, 14632194
Weight Loss	Associate	28275132

MCHR1 (melanin concentrating hormone receptor 1)