Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	284541
Gene name	Cytochrome P450 family 4 subfamily A member 22
Gene symbol	CYP4A22
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1p33
Summary	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part

Show/Hide all (73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029322	hsa-miR-26b-5p	Microarray	19088304
MIRT483373	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT483374	hsa-miR-4781-3p	PAR-CLIP	23592263
MIRT483372	hsa-miR-506-5p	PAR-CLIP	23592263
MIRT483371	hsa-miR-211-3p	PAR-CLIP	23592263
MIRT483370	hsa-miR-4270	PAR-CLIP	23592263
MIRT483369	hsa-miR-4441	PAR-CLIP	23592263
MIRT483368	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT483367	hsa-miR-6134	PAR-CLIP	23592263
MIRT483365	hsa-miR-4683	PAR-CLIP	23592263
MIRT483366	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT483364	hsa-miR-6745	PAR-CLIP	23592263
MIRT483363	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT483362	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT483361	hsa-miR-1293	PAR-CLIP	23592263
MIRT483359	hsa-miR-4483	PAR-CLIP	23592263
MIRT483360	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT483358	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT483357	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT483356	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT483355	hsa-miR-3127-5p	PAR-CLIP	23592263
MIRT483354	hsa-miR-1270	PAR-CLIP	23592263
MIRT483352	hsa-miR-620	PAR-CLIP	23592263
MIRT455956	hsa-miR-3154	PAR-CLIP	23592263
MIRT455955	hsa-miR-4690-5p	PAR-CLIP	23592263
MIRT455954	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT455953	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT455952	hsa-miR-940	PAR-CLIP	23592263
MIRT455951	hsa-miR-9500	PAR-CLIP	23592263
MIRT455950	hsa-miR-3185	PAR-CLIP	23592263
MIRT455949	hsa-miR-7515	PAR-CLIP	23592263
MIRT455948	hsa-miR-3665	PAR-CLIP	23592263
MIRT455947	hsa-miR-4736	PAR-CLIP	23592263
MIRT455946	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT455945	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT455944	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT455943	hsa-miR-654-5p	PAR-CLIP	23592263
MIRT483373	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT483374	hsa-miR-4781-3p	PAR-CLIP	23592263
MIRT483372	hsa-miR-506-5p	PAR-CLIP	23592263
MIRT483371	hsa-miR-211-3p	PAR-CLIP	23592263
MIRT483370	hsa-miR-4270	PAR-CLIP	23592263
MIRT483369	hsa-miR-4441	PAR-CLIP	23592263
MIRT483368	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT483367	hsa-miR-6134	PAR-CLIP	23592263
MIRT483365	hsa-miR-4683	PAR-CLIP	23592263
MIRT483366	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT483364	hsa-miR-6745	PAR-CLIP	23592263
MIRT483363	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT483362	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT483361	hsa-miR-1293	PAR-CLIP	23592263
MIRT483359	hsa-miR-4483	PAR-CLIP	23592263
MIRT483360	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT483358	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT483357	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT483356	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT483355	hsa-miR-3127-5p	PAR-CLIP	23592263
MIRT483354	hsa-miR-1270	PAR-CLIP	23592263
MIRT483352	hsa-miR-620	PAR-CLIP	23592263
MIRT455956	hsa-miR-3154	PAR-CLIP	23592263
MIRT455955	hsa-miR-4690-5p	PAR-CLIP	23592263
MIRT455954	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT455953	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT455952	hsa-miR-940	PAR-CLIP	23592263
MIRT455951	hsa-miR-9500	PAR-CLIP	23592263
MIRT455950	hsa-miR-3185	PAR-CLIP	23592263
MIRT455949	hsa-miR-7515	PAR-CLIP	23592263
MIRT455948	hsa-miR-3665	PAR-CLIP	23592263
MIRT455947	hsa-miR-4736	PAR-CLIP	23592263
MIRT455946	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT455945	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT455944	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT455943	hsa-miR-654-5p	PAR-CLIP	23592263

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	IBA
GO:0002933	Process	Lipid hydroxylation	IDA	10860550
GO:0004497	Function	Monooxygenase activity	IEA
GO:0005506	Function	Iron ion binding	IEA
GO:0005615	Component	Extracellular space	IDA	16806293
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008391	Function	Arachidonate monooxygenase activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0018685	Function	Alkane 1-monooxygenase activity	IBA
GO:0019369	Process	Arachidonate metabolic process	IBA
GO:0020037	Function	Heme binding	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0043651	Process	Linoleic acid metabolic process	IBA
GO:0046456	Process	Icosanoid biosynthetic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048252	Process	Lauric acid metabolic process	IBA
GO:0052869	Function	Arachidonate omega-hydroxylase activity	IDA	10860550
GO:0097267	Process	Omega-hydroxylase P450 pathway	IDA	10860550
GO:0102033	Function	Long-chain fatty acid omega-hydroxylase activity	IEA
GO:0103002	Function	16-hydroxypalmitate dehydrogenase activity	IDA	10860550
GO:0140981	Function	Medium-chain fatty acid omega-hydroxylase activity	IDA	10860550

MIM	HGNC	e!Ensembl
615341	20575	ENSG00000162365

Q5TCH4

Protein name

Cytochrome P450 4A22 (CYPIVA22) (Fatty acid omega-hydroxylase) (Lauric acid omega-hydroxylase) (Long-chain fatty acid omega-monooxygenase) (EC 1.14.14.80)

Protein function

Catalyzes the omega- and (omega-1)-hydroxylation of various fatty acids such as laurate and palmitate. Shows no activity towards arachidonic acid and prostaglandin A1. Lacks functional activity in the kidney and does not contribute to renal 20-h

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00067	p450	51 → 505	Cytochrome P450	Domain

Sequence

MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLF
GHIQEFQHDQELQRIQERVKTFPSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSHGSY
KFLAPRIGYGLLLLNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQD
SPLEVFQHVSLMTLDTIMKSAFSHQGSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHEND
TIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKM
ENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGDGAS
ITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH
NPKVWPNLEVFDPSRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFEL
LPDPTRIPIPMARLVLKSKNGIHLRLRRLPNPCEDKDQL

Sequence length

519

Interactions

View interactions

	Reactome
			Fatty acids Miscellaneous substrates Eicosanoids Synthesis of Leukotrienes (LT) and Eoxins (EX)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary disease, chronic obstructive, susceptibility to	association	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Hypospadias	Associate	32728162	★★★★★ ★☆☆☆☆ Found in Text Mining only

CYP4A22 (cytochrome P450 family 4 subfamily A member 22)