ZNF875 (zinc finger protein 875)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 284459
Gene name Zinc finger protein 875
Gene symbol ZNF875
Synonyms (NCBI Gene)
HKR1
Chromosome 19
Chromosome location 19q13.12
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
165250 4928 ENSG00000181666
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P10072
Protein name Zinc finger protein 875 (Krueppel-related zinc finger protein 1) (Protein HKR1)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 32 → 73 KRAB box Family
PF00096 zf-C2H2 301 → 323 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 329 → 351 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 357 → 379 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 385 → 407 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 413 → 435 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 441 → 463 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 469 → 491 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 497 → 519 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 525 → 547 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 553 → 575 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 607 → 629 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 635 → 657 Zinc finger, C2H2 type Domain
Sequence 
MRVNHTVSTMLPTCMVHRQTMSCSGAGGITAFVAFRDVAVYFTQEEWRLLSPAQRTLHRE
VMLETYNHLVSLEIPSSKPKLIAQLERGEAPWREERKCPLDLCPESKPEIQLSPSCPLIF
SSQQALSQHVWLSHLSQLFSSLWAGNPLHLGKHYPEDQKQQQDPFCFSGKAEWIQEGEDS
RLLFGRVSKNGTSKALSSPPEEQQPAQSKEDNTVVDIGSSPERRADLEETDKVLHGLEVS
GFGEIKYEEFGPGFIKESNLLSLQKTQTGETPYMYTEWGDSFGSMSVLIKNPRTHSGGKP
YVCRECGRGFTWKSNLITHQRTHSGEKPYVCKDCGRGFTWKSNLFTHQRTHSGLKPYVCK
ECGQSFSLKSNLITHQRAHTGEKPYVCRECGRGFRQHSHLVRHKRTHSGEKPYICRECEQ
GFSQKSHLIRHLRTHTGEKPYVCTECGRHFSWKSNLKTHQRTHSGVKPYVCLECGQCFSL
KSNLNKHQRSHTGEKPFVCTECGRGFTRKSTLSTHQRTHSGEKPFVCAECGRGFNDKSTL
ISHQRTHSGEKPFMCRECGRRFRQKPNLFRHKRAHSGAFVCRECGQGFCAKLTLIKHQRA
HAGGKPHVCRECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRGFSRKSNLIRHQRTHSG
Sequence length 659
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (3)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Arthrogryposis multiplex congenita Uncertain significance ClinVar
Disgenet
★★★★★
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Fetal akinesia deformation sequence 1 Uncertain significance ClinVar
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PENA-SHOKEIR SYNDROME TYPE I — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (3)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Alzheimer Disease Associate 35627223, 40244264
★★★★★
★☆☆☆☆
Found in Text Mining only
Prostatic Neoplasms Associate 40312663
★★★★★
★☆☆☆☆
Found in Text Mining only
Prostatitis Associate 40312663
★★★★★
★☆☆☆☆
Found in Text Mining only