ZNF575 (zinc finger protein 575)

Gene

• Entrez ID: 284346
• Gene name: Zinc finger protein 575
• Gene symbol: ZNF575
• Synonyms (NCBI Gene): -
• Chromosome: 19
• Chromosome location: 19q13.31

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2160311	hsa-miR-140-3p	CLIP-seq
MIRT2160312	hsa-miR-297	CLIP-seq
MIRT2160313	hsa-miR-3672	CLIP-seq
MIRT2160314	hsa-miR-3924	CLIP-seq
MIRT2160315	hsa-miR-567	CLIP-seq
MIRT2160311	hsa-miR-140-3p	CLIP-seq
MIRT2379637	hsa-miR-939	CLIP-seq
MIRT2464364	hsa-miR-1202	CLIP-seq
MIRT2464365	hsa-miR-146b-3p	CLIP-seq
MIRT2464366	hsa-miR-188-5p	CLIP-seq
MIRT2464367	hsa-miR-3157-3p	CLIP-seq
MIRT2464368	hsa-miR-3173-5p	CLIP-seq
MIRT2464369	hsa-miR-3194-5p	CLIP-seq
MIRT2464370	hsa-miR-3972	CLIP-seq
MIRT2464371	hsa-miR-4290	CLIP-seq
MIRT2464372	hsa-miR-4727-5p	CLIP-seq
MIRT2464373	hsa-miR-4769-3p	CLIP-seq
MIRT2464374	hsa-miR-4780	CLIP-seq
MIRT2464375	hsa-miR-623	CLIP-seq
MIRT2464376	hsa-miR-874	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q86XF7
• Protein name: Zinc finger protein 575
• Protein function: May be involved in transcriptional regulation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	63 → 85	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	91 → 113	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	119 → 141	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	147 → 170	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	177 → 199	Zinc finger, C2H2 type	Domain

• Sequence:

  MLERGAESAAGATDPSPTGKEPVTKEAPHQGPPQKPSQSAPGPTASAGSPPRPRRRPPPQ
  RPHRCPDCDKAFSYPSKLATHRLAHGGARPHPCPDCPKAFSYPSKLAAHRLTHSGARPHP
  CPHCPKSFGHRSKLAAHLWTHAPTRPYPCPDCPKSFCYPSKLAAHRHTHHATDARPYPCP
  HCPKAFSFPSKLAAHRLCHDPPTAPGSQATAWHRCSSCGQAFGQRRLLLLHQRSHHQVEH
  KGERD

• Sequence length: 245

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Ethylmalonic encephalopathy	Ethylmalonic encephalopathy	rs28940289, rs119103249, rs387906987, rs267605525, rs863223954, rs745656120, rs863223955, rs935855792, rs756235299, rs1555762722, rs763799125, rs769259233, rs1284200516, rs1555765701, rs1555765689, rs761827730, rs368778231, rs1555762753, rs1555762070, rs1555761934, rs1555765524, rs761661864, rs749803238, rs1470124674, rs1600019095	14732903, 26917598, 19136963, 29526615, 18593870, 16183799

Associations from Text Mining
Disease Name	Relationship Type	References
Carcinoma Non Small Cell Lung	Associate	24175795