DYNAP (dynactin associated protein)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 284254
Gene name Dynactin associated protein
Gene symbol DYNAP
Synonyms (NCBI Gene)
C18orf26
Chromosome 18
Chromosome location 18q21.2
miRNA miRNA information provided by mirtarbase database.
54
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (54)
miRTarBase ID miRNA Experiments Reference
MIRT513108 hsa-miR-4676-5p PAR-CLIP 23446348
MIRT513109 hsa-miR-575 PAR-CLIP 23446348
MIRT513106 hsa-miR-4302 PAR-CLIP 23446348
MIRT513107 hsa-miR-199a-5p PAR-CLIP 23446348
MIRT513105 hsa-miR-199b-5p PAR-CLIP 23446348
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (15)
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005515 Function Protein binding IPI 20978158
GO:0005794 Component Golgi apparatus IBA
GO:0005794 Component Golgi apparatus IDA 20978158
GO:0005794 Component Golgi apparatus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
619421 26808 ENSG00000178690
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N1N2
Protein name Dynactin-associated protein (Full)
Protein function Plays a role in the regulation of cell proliferation. Promotes activation of the AKT1 signaling pathway. Promotes phosphorylation of AKT1 at 'Ser-473'.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15675 CLLAC 108 → 137 CLLAC-motif containing domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in fibroblast and numerous cancer cell lines (at protein level). {ECO:0000269|PubMed:20978158}.
Sequence 
MVADIKGNEQIEKYSWREACDTGSSRMDRKHGKYILNVEHSENQPPITHPNDQEAHSSIC
WCLPSNDITSDVSPNLTGVCVNPGILAHSRCLQSESCNTQVKEYCRNDWSMWKVFLACLL
ACVIMTAIGVLIICLVNNKGSANSSIVIQLSTNDGECVTVKPGTPSPACPPTMTTTSTVP
ASTATESTTSTATAATTSTEPITVAPTDHL
Sequence length 210
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (3)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASTHMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
UVEAL MELANOMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (1)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Carcinoma Squamous Cell Associate 36456645
★★★★★
★☆☆☆☆
Found in Text Mining only