Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	284207
Gene name	Meteorin like, glial cell differentiation regulator
Gene symbol	METRNL
Synonyms (NCBI Gene)	-
Chromosome	17
Chromosome location	17q25.3

158

Show/Hide all (158)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026973	hsa-miR-107	Microarray	20489155
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	20371350
MIRT504492	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	20371350
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	20371350
MIRT504492	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	20371350
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	21572407
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	21572407
MIRT504492	hsa-miR-140-3p	PAR-CLIP	21572407
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	21572407
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	22012620
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	22012620
MIRT530086	hsa-miR-1178-5p	PAR-CLIP	22012620
MIRT504492	hsa-miR-140-3p	PAR-CLIP	22012620
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	22012620
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	23446348
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	23446348
MIRT504492	hsa-miR-140-3p	PAR-CLIP	23446348
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	23446348
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	23446348
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	23446348
MIRT504492	hsa-miR-140-3p	PAR-CLIP	23446348
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	23446348
MIRT504492	hsa-miR-140-3p	PAR-CLIP	26701625
MIRT504492	hsa-miR-140-3p	PAR-CLIP	26701625
MIRT504492	hsa-miR-140-3p	PAR-CLIP	26701625
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	26701625
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	26701625
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	26701625
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	26701625
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	26701625
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	26701625
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	26701625
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	26701625
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	26701625
MIRT504492	hsa-miR-140-3p	PAR-CLIP	27292025
MIRT504492	hsa-miR-140-3p	PAR-CLIP	27292025
MIRT504492	hsa-miR-140-3p	PAR-CLIP	27292025
MIRT504492	hsa-miR-140-3p	PAR-CLIP	27292025
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	27292025
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	27292025
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	27292025
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	27292025
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	27292025
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	27292025
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	27292025
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	27292025
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	27292025
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	27292025
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	27292025
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	27292025
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	20371350
MIRT504492	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	20371350
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	20371350
MIRT504492	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	20371350
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	21572407
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	21572407
MIRT504492	hsa-miR-140-3p	PAR-CLIP	21572407
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	21572407
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	22012620
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	22012620
MIRT530086	hsa-miR-1178-5p	PAR-CLIP	22012620
MIRT504492	hsa-miR-140-3p	PAR-CLIP	22012620
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	22012620
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	23446348
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	23446348
MIRT504492	hsa-miR-140-3p	PAR-CLIP	23446348
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	23446348
MIRT504494	hsa-miR-1911-3p	PAR-CLIP	23446348
MIRT504493	hsa-miR-6753-5p	PAR-CLIP	23446348
MIRT504492	hsa-miR-140-3p	PAR-CLIP	23446348
MIRT504491	hsa-miR-4798-5p	PAR-CLIP	23446348
MIRT1143650	hsa-miR-1280	CLIP-seq
MIRT1143651	hsa-miR-134	CLIP-seq
MIRT1143652	hsa-miR-3118	CLIP-seq
MIRT1143653	hsa-miR-3120-3p	CLIP-seq
MIRT1143654	hsa-miR-3125	CLIP-seq
MIRT1143655	hsa-miR-3164	CLIP-seq
MIRT1143656	hsa-miR-3170	CLIP-seq
MIRT1143657	hsa-miR-3177-3p	CLIP-seq
MIRT1143658	hsa-miR-3189-3p	CLIP-seq
MIRT1143659	hsa-miR-3202	CLIP-seq
MIRT1143660	hsa-miR-33a	CLIP-seq
MIRT1143661	hsa-miR-33b	CLIP-seq
MIRT1143662	hsa-miR-362-5p	CLIP-seq
MIRT1143663	hsa-miR-3652	CLIP-seq
MIRT1143664	hsa-miR-3659	CLIP-seq
MIRT1143665	hsa-miR-369-3p	CLIP-seq
MIRT1143666	hsa-miR-374a	CLIP-seq
MIRT1143667	hsa-miR-374b	CLIP-seq
MIRT1143668	hsa-miR-3916	CLIP-seq
MIRT1143669	hsa-miR-4310	CLIP-seq
MIRT1143670	hsa-miR-4430	CLIP-seq
MIRT1143671	hsa-miR-4433	CLIP-seq
MIRT1143672	hsa-miR-4436b-3p	CLIP-seq
MIRT1143673	hsa-miR-4459	CLIP-seq
MIRT1143674	hsa-miR-4476	CLIP-seq
MIRT1143675	hsa-miR-4505	CLIP-seq
MIRT1143676	hsa-miR-4658	CLIP-seq
MIRT1143677	hsa-miR-4685-5p	CLIP-seq
MIRT1143678	hsa-miR-4733-3p	CLIP-seq
MIRT1143679	hsa-miR-4758-3p	CLIP-seq
MIRT1143680	hsa-miR-4758-5p	CLIP-seq
MIRT1143681	hsa-miR-4761-3p	CLIP-seq
MIRT1143682	hsa-miR-4768-3p	CLIP-seq
MIRT1143683	hsa-miR-500b	CLIP-seq
MIRT1143684	hsa-miR-574-5p	CLIP-seq
MIRT1143685	hsa-miR-644	CLIP-seq
MIRT1143686	hsa-miR-647	CLIP-seq
MIRT1143687	hsa-miR-671-5p	CLIP-seq
MIRT1143653	hsa-miR-3120-3p	CLIP-seq
MIRT1143656	hsa-miR-3170	CLIP-seq
MIRT1143658	hsa-miR-3189-3p	CLIP-seq
MIRT1143660	hsa-miR-33a	CLIP-seq
MIRT1143661	hsa-miR-33b	CLIP-seq
MIRT1143662	hsa-miR-362-5p	CLIP-seq
MIRT1143663	hsa-miR-3652	CLIP-seq
MIRT1143664	hsa-miR-3659	CLIP-seq
MIRT1143669	hsa-miR-4310	CLIP-seq
MIRT1143670	hsa-miR-4430	CLIP-seq
MIRT1143675	hsa-miR-4505	CLIP-seq
MIRT1143676	hsa-miR-4658	CLIP-seq
MIRT1143677	hsa-miR-4685-5p	CLIP-seq
MIRT1143680	hsa-miR-4758-5p	CLIP-seq
MIRT1143681	hsa-miR-4761-3p	CLIP-seq
MIRT1143683	hsa-miR-500b	CLIP-seq
MIRT1143684	hsa-miR-574-5p	CLIP-seq
MIRT1143685	hsa-miR-644	CLIP-seq
MIRT1143686	hsa-miR-647	CLIP-seq
MIRT1143687	hsa-miR-671-5p	CLIP-seq
MIRT1143653	hsa-miR-3120-3p	CLIP-seq
MIRT1143656	hsa-miR-3170	CLIP-seq
MIRT1143658	hsa-miR-3189-3p	CLIP-seq
MIRT1143660	hsa-miR-33a	CLIP-seq
MIRT1143661	hsa-miR-33b	CLIP-seq
MIRT1143662	hsa-miR-362-5p	CLIP-seq
MIRT1143663	hsa-miR-3652	CLIP-seq
MIRT1143664	hsa-miR-3659	CLIP-seq
MIRT1143669	hsa-miR-4310	CLIP-seq
MIRT1143670	hsa-miR-4430	CLIP-seq
MIRT1143675	hsa-miR-4505	CLIP-seq
MIRT1143676	hsa-miR-4658	CLIP-seq
MIRT1143677	hsa-miR-4685-5p	CLIP-seq
MIRT1143680	hsa-miR-4758-5p	CLIP-seq
MIRT1143681	hsa-miR-4761-3p	CLIP-seq
MIRT1143683	hsa-miR-500b	CLIP-seq
MIRT1143684	hsa-miR-574-5p	CLIP-seq
MIRT1143686	hsa-miR-647	CLIP-seq
MIRT1143687	hsa-miR-671-5p	CLIP-seq
MIRT1143657	hsa-miR-3177-3p	CLIP-seq
MIRT2453999	hsa-miR-4479	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS	24393292
GO:0007165	Process	Signal transduction	IEA
GO:0009409	Process	Response to cold	IEA
GO:0009409	Process	Response to cold	ISS
GO:0014850	Process	Response to muscle activity	IEA
GO:0014850	Process	Response to muscle activity	ISS
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	ISS	24393292
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	ISS
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0090336	Process	Positive regulation of brown fat cell differentiation	IBA
GO:0090336	Process	Positive regulation of brown fat cell differentiation	IEA
GO:0090336	Process	Positive regulation of brown fat cell differentiation	ISS
GO:0097009	Process	Energy homeostasis	IBA
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS

MIM	HGNC	e!Ensembl
616241	27584	ENSG00000176845

Q641Q3

Protein name

Meteorin-like protein (Subfatin)

Protein function

Hormone induced following exercise or cold exposure that promotes energy expenditure. Induced either in the skeletal muscle after exercise or in adipose tissue following cold exposure and is present in the circulation. Able to stimulate energy e

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the skeletal muscle, in subcutaneous adipose tissue, epididymal white adipose tissue depots and heart. Also expressed in brown adipose tissues and kidney. {ECO:0000269|PubMed:24393292, ECO:0000269|PubMed:24906147}.

Sequence

MRGAARAAWGRAGQPWPRPPAPGPPPPPLPLLLLLLAGLLGGAGAQYSSDRCSWKGSGLT
HEAHRKEVEQVYLRCAAGAVEWMYPTGALIVNLRPNTFSPARHLTVCIRSFTDSSGANIY
LEKTGELRLLVPDGDGRPGRVQCFGLEQGGLFVEATPQQDIGRRTTGFQYELVRRHRASD
LHELSAPCRPCSDTEVLLAVCTSDFAVRGSIQQVTHEPERQDSAIHLRVSRLYRQKSRVF
EPVPEGDGHWQGRVRTLLECGVRPGHGDFLFTGHMHFGEARLGCAPRFKDFQRMYRDAQE
RGLNPCEVGTD

Sequence length

311

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BENIGN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Psoriatic	Associate	31470086	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	37632791	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Inhibit	30212581	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Inhibit	30212581	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	31635130	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	30212581	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	30212581	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Inhibit	30212581	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Stimulate	31635130	★★★★★ ★☆☆☆☆ Found in Text Mining only
Simpson Golabi Behmel syndrome	Associate	36936161	★★★★★ ★☆☆☆☆ Found in Text Mining only

METRNL (meteorin like, glial cell differentiation regulator)