Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2842
Gene name Gene Name - the full gene name approved by the HGNC.
G protein-coupled receptor 19
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GPR19
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024505 hsa-miR-215-5p Microarray 19074876
MIRT025726 hsa-miR-7-5p Microarray 17612493
MIRT026563 hsa-miR-192-5p Microarray 19074876
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade NAS 20018936
GO:0004930 Function G protein-coupled receptor activity IBA
GO:0004930 Function G protein-coupled receptor activity IDA 37923782
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity TAS 8830667
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602927 4473 ENSG00000183150
Protein
UniProt ID Q15760
Protein name Probable G-protein coupled receptor 19 (GPR-NGA)
Protein function G-protein coupled receptor that plays a role in the regulation of circadian rhythms and energy metabolism. Participates in maintaining proper circadian gene expression in the suprachiasmatic nucleus (SCN), the locus of the master circadian clock
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 82 330 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Abundant expression in the brain.
Sequence
MVFAHRMDNSKPHLIIPTLLVPLQNRSCTETATPLPSQYLMELSEEHSWMSNQTDLHYVL
KPGEVATASIFFGILWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTP
FVLLQFTTGRWTLGSATCKVVRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKA
KKMIAASWVFDAGFVTPVLFFYGSNWDSHCNYFLPSSWEGTAYTVIHFLVGFVIPSVLII
LFYQKVIKYIWRIGTDGRTVRRTMNIVPRTKVKTIKMFLILNLLFLLSWLPFHVAQLWHP
HEQDYKKSSLVFTAITWISFSSSASKPTLY
SIYNANFRRGMKETFCMSSMKCYRSNAYTI
TTSSRMAKKNYVGISEIPSMAKTITKDSIYDSFDREAKEKKLAWPINSNPPNTFV
Sequence length 415
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adrenocortical Carcinoma Associate 33133015
Breast Neoplasms Associate 28476646
Cardiovascular Diseases Associate 30466987
Cognitive Dysfunction Associate 30466987
Dyslipidemias Associate 30466987
Hypertension Associate 30466987
Hypertensive Retinopathy Associate 30466987
Inflammation Associate 30466987
Intellectual Disability Associate 30466987
Lung Neoplasms Associate 22912338