GPR19 (G protein-coupled receptor 19)

Gene

• Entrez ID: 2842
• Gene name: G protein-coupled receptor 19
• Gene symbol: GPR19
• Synonyms (NCBI Gene): -
• Chromosome: 12
• Chromosome location: 12p13.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024505	hsa-miR-215-5p	Microarray	19074876
MIRT025726	hsa-miR-7-5p	Microarray	17612493
MIRT026563	hsa-miR-192-5p	Microarray	19074876

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	NAS	20018936
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IDA	37923782
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	8830667
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	37923782
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8830667
GO:0005929	Component	Cilium	IDA	28154160
GO:0005929	Component	Cilium	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	37923782
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8830667
GO:0016020	Component	Membrane	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0043005	Component	Neuron projection	IEA

Other IDs

• MIM: 602927
• HGNC: 4473
• e!Ensembl: ENSG00000183150

Protein

• UniProt ID: Q15760
• Protein name: Probable G-protein coupled receptor 19 (GPR-NGA)
• Protein function: G-protein coupled receptor that plays a role in the regulation of circadian rhythms and energy metabolism. Participates in maintaining proper circadian gene expression in the suprachiasmatic nucleus (SCN), the locus of the master circadian clock
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	82 → 330	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Abundant expression in the brain.
• Sequence:

  MVFAHRMDNSKPHLIIPTLLVPLQNRSCTETATPLPSQYLMELSEEHSWMSNQTDLHYVL
  KPGEVATASIFFGILWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTP
  FVLLQFTTGRWTLGSATCKVVRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKA
  KKMIAASWVFDAGFVTPVLFFYGSNWDSHCNYFLPSSWEGTAYTVIHFLVGFVIPSVLII
  LFYQKVIKYIWRIGTDGRTVRRTMNIVPRTKVKTIKMFLILNLLFLLSWLPFHVAQLWHP
  HEQDYKKSSLVFTAITWISFSSSASKPTLYSIYNANFRRGMKETFCMSSMKCYRSNAYTI
  TTSSRMAKKNYVGISEIPSMAKTITKDSIYDSFDREAKEKKLAWPINSNPPNTFV

• Sequence length: 415

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adrenocortical Carcinoma	Associate	33133015	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	28476646	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	30466987	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Associate	30466987	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Associate	30466987	★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	30466987	★☆☆☆☆ Found in Text Mining only
Hypertensive Retinopathy	Associate	30466987	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	30466987	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Associate	30466987	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	22912338	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Associate	30466987	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	28476646	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	30466987	★☆☆☆☆ Found in Text Mining only
Neurologic Manifestations	Associate	30466987	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Stimulate	22912338	★☆☆☆☆ Found in Text Mining only