Gene Gene information from NCBI Gene database.
Entrez ID 284106
Gene name CDGSH iron sulfur domain 3
Gene symbol CISD3
Synonyms (NCBI Gene)
MiNTMiner2
Chromosome 17
Chromosome location 17q12
Summary CISD3 is a member of the CDGSH domain-containing family, which may play a role in regulating electron transport and oxidative phosphorylation (Wiley et al., 2007 [PubMed 17376863]).[supplied by OMIM, Apr 2008]
miRNA miRNA information provided by mirtarbase database.
462
miRTarBase ID miRNA Experiments Reference
MIRT615087 hsa-miR-1914-5p HITS-CLIP 23824327
MIRT615086 hsa-miR-2682-3p HITS-CLIP 23824327
MIRT615085 hsa-miR-6781-3p HITS-CLIP 23824327
MIRT615084 hsa-miR-6867-5p HITS-CLIP 23824327
MIRT615082 hsa-miR-5001-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IDA 17376863
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611933 27578 ENSG00000277972
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0C7P0
Protein name CDGSH iron-sulfur domain-containing protein 3, mitochondrial (MitoNEET-related protein 2) (Miner2) (Mitochondrial inner NEET protein) (MiNT)
Protein function Can transfer its iron-sulfur clusters to the apoferrodoxins FDX1 and FDX2. Contributes to mitochondrial iron homeostasis and in maintaining normal levels of free iron and reactive oxygen species, and thereby contributes to normal mitochondrial f
PDB 6AVJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09360 zf-CDGSH 38 76 Iron-binding zinc finger CDGSH type Domain
PF09360 zf-CDGSH 81 114 Iron-binding zinc finger CDGSH type Domain
Sequence
MRGAGAILRPAARGARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWC
VCGRSKKQPFCDGSHF
FQRTGLSPLKFKAQETRMVALCTCKATQRPPYCDGTHRSERVQK
AEVGSPL
Sequence length 127
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
TURNPENNY-FRY SYNDROME Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
WOLFRAM SYNDROME 2 Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Cardiovascular Diseases Associate 29556009
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Associate 29556009
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 2 Associate 28082676
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 29259115, 29556009
★☆☆☆☆
Found in Text Mining only
Neurodegenerative Diseases Associate 29556009
★☆☆☆☆
Found in Text Mining only
Obesity Associate 29556009
★☆☆☆☆
Found in Text Mining only
Wolfram Syndrome 2 Associate 28082676
★★☆☆☆
Found in Text Mining + Unknown/Other Associations