Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
284018
Gene name Gene Name - the full gene name approved by the HGNC.
Chromosome 17 open reading frame 58
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
C17orf58
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q24.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024426 hsa-miR-215-5p Microarray 19074876
MIRT026391 hsa-miR-192-5p Microarray 19074876
MIRT039264 hsa-miR-671-5p CLASH 23622248
MIRT562857 hsa-miR-4668-3p PAR-CLIP 20371350
MIRT562855 hsa-miR-3662 PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0031012 Component Extracellular matrix HDA 25037231
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
UniProt ID Q2M2W7
Protein name UPF0450 protein C17orf58
Family and domains
Sequence
MNRLYLTPDGFFFRVHMLALDSSSCNKPCPEFKPGSRYIVMGHIYHKRRQLPTALLQVLR
GRLRPGDGLLRSSSSYVKRFNRKREGQIQGAIHTQCI
Sequence length 97
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS