Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2840
Gene name Gene Name - the full gene name approved by the HGNC.	G protein-coupled receptor 17
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPR17
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q14.3

Show/Hide all(26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018345	hsa-miR-335-5p	Microarray	18185580
MIRT029794	hsa-miR-26b-5p	Microarray	19088304
MIRT1030888	hsa-miR-1236	CLIP-seq
MIRT1030889	hsa-miR-185	CLIP-seq
MIRT1030890	hsa-miR-2682	CLIP-seq
MIRT1030891	hsa-miR-34a	CLIP-seq
MIRT1030892	hsa-miR-34c-5p	CLIP-seq
MIRT1030893	hsa-miR-4269	CLIP-seq
MIRT1030894	hsa-miR-4302	CLIP-seq
MIRT1030895	hsa-miR-4306	CLIP-seq
MIRT1030896	hsa-miR-449a	CLIP-seq
MIRT1030897	hsa-miR-449b	CLIP-seq
MIRT1030898	hsa-miR-449c	CLIP-seq
MIRT1030899	hsa-miR-4514	CLIP-seq
MIRT1030900	hsa-miR-4644	CLIP-seq
MIRT1030901	hsa-miR-4692	CLIP-seq
MIRT1030902	hsa-miR-4722-5p	CLIP-seq
MIRT1030903	hsa-miR-4742-5p	CLIP-seq
MIRT1030904	hsa-miR-4768-3p	CLIP-seq
MIRT1030905	hsa-miR-510	CLIP-seq
MIRT1030906	hsa-miR-520a-5p	CLIP-seq
MIRT1030907	hsa-miR-525-5p	CLIP-seq
MIRT1030908	hsa-miR-593	CLIP-seq
MIRT2005826	hsa-miR-193a-5p	CLIP-seq
MIRT2450622	hsa-miR-136	CLIP-seq
MIRT2450623	hsa-miR-3127-5p	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	8558062
GO:0005515	Function	Protein binding	IPI	36613703
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8558062
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8558062
GO:0016020	Component	Membrane	IEA
GO:0033612	Function	Receptor serine/threonine kinase binding	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA

MIM	HGNC	e!Ensembl
603071	4471	ENSG00000144230

Protein

UniProt ID

Q13304

Protein name

Uracil nucleotide/cysteinyl leukotriene receptor (UDP/CysLT receptor) (G-protein coupled receptor 17) (P2Y-like receptor) (R12)

Protein function

Dual specificity receptor for uracil nucleotides and cysteinyl leukotrienes (CysLTs). Signals through G(i) and inhibition of adenylyl cyclase. May mediate brain damage by nucleotides and CysLTs following ischemia.

PDB

7Y89

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	76 → 325	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, kidney, heart and umbilical vein endothelial cells. Highest level in brain. {ECO:0000269|PubMed:16990797}.

Sequence

MSKRSWWAGSRKPPREMLKLSGSDSSQSMNGLEVAPPGLITNFSLATAEQCGQETPLENM
LFASFYLLDFILALVGNTLALWLFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHF
SGNHWPFGEIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLAC
AFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALVSLAVAFTFPFITTVTCY
LLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYHVNRSVYVLHYRSHGASCATQ
RILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESS
LSAKSEL

Sequence length

367

Interactions

View interactions

	Reactome
			Leukotriene receptors G alpha (q) signalling events P2Y receptors G alpha (i) signalling events

GPR17 (G protein-coupled receptor 17)