Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
284
Gene name Gene Name - the full gene name approved by the HGNC.
Angiopoietin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ANGPT1
Synonyms (NCBI Gene) Gene synonyms aliases
AGP1, AGPT, AGPT-1, ANG1, HAE5
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a secreted glycoprotein that belongs to the angiopoietin family. Members of this family play important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT781397 hsa-miR-1253 CLIP-seq
MIRT781398 hsa-miR-3074-3p CLIP-seq
MIRT781399 hsa-miR-3161 CLIP-seq
MIRT781400 hsa-miR-3163 CLIP-seq
MIRT781401 hsa-miR-3919 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
ING4 Repression 20707719
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IBA
GO:0001525 Process Angiogenesis IEA
GO:0001525 Process Angiogenesis IEA
GO:0001568 Process Blood vessel development IEA
GO:0001701 Process In utero embryonic development IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601667 484 ENSG00000154188
Protein
UniProt ID Q15389
Protein name Angiopoietin-1 (ANG-1)
Protein function Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorgan
PDB 4EPU , 4JYO , 4K0V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00147 Fibrinogen_C 282 496 Fibrinogen beta and gamma chains, C-terminal globular domain Domain
Sequence
MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRA
TTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
GPSYSLRSTTMMIRPL
DF
Sequence length 498
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Rheumatoid arthritis
  Tie2 Signaling
RAF/MAP kinase cascade
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Angioedema angioedema, hereditary, 5 N/A N/A GenCC
Congenital glaucoma primary congenital glaucoma N/A N/A GenCC
Glaucoma glaucoma, Glaucoma N/A N/A GenCC, GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 32680471
Adenocarcinoma Inhibit 17785951
Adenocarcinoma of Lung Inhibit 22048948
Adenocarcinoma of Lung Associate 32669531, 34039311
Alzheimer Disease Associate 39394418
Angioedemas Hereditary Associate 32578786, 33593719, 33799813, 36787826
Arthritis Associate 12525377
Arthritis Juvenile Associate 20722033
Arthritis Rheumatoid Associate 12010571, 12525377
Atherosclerosis Associate 26283334