Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	284
Gene name Gene Name - the full gene name approved by the HGNC.	Angiopoietin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ANGPT1
Synonyms (NCBI Gene) Gene synonyms aliases	AGP1, AGPT, AGPT-1, ANG1, HAE5
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q23.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a secreted glycoprotein that belongs to the angiopoietin family. Members of this family play important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-

Show/Hide all(127)

miRTarBase ID	miRNA	Experiments
MIRT781397	hsa-miR-1253	CLIP-seq
MIRT781398	hsa-miR-3074-3p	CLIP-seq
MIRT781399	hsa-miR-3161	CLIP-seq
MIRT781400	hsa-miR-3163	CLIP-seq
MIRT781401	hsa-miR-3919	CLIP-seq
MIRT781402	hsa-miR-4328	CLIP-seq
MIRT781403	hsa-miR-4705	CLIP-seq
MIRT781404	hsa-miR-526b	CLIP-seq
MIRT781397	hsa-miR-1253	CLIP-seq
MIRT781405	hsa-miR-1287	CLIP-seq
MIRT781406	hsa-miR-137	CLIP-seq
MIRT781407	hsa-miR-181a	CLIP-seq
MIRT781408	hsa-miR-181b	CLIP-seq
MIRT781409	hsa-miR-181c	CLIP-seq
MIRT781410	hsa-miR-181d	CLIP-seq
MIRT781411	hsa-miR-3135b	CLIP-seq
MIRT781412	hsa-miR-3154	CLIP-seq
MIRT781413	hsa-miR-3202	CLIP-seq
MIRT781414	hsa-miR-338-5p	CLIP-seq
MIRT781415	hsa-miR-3682-3p	CLIP-seq
MIRT781416	hsa-miR-4262	CLIP-seq
MIRT781417	hsa-miR-4428	CLIP-seq
MIRT781418	hsa-miR-4533	CLIP-seq
MIRT781419	hsa-miR-4716-5p	CLIP-seq
MIRT781420	hsa-miR-4738-3p	CLIP-seq
MIRT781421	hsa-miR-4774-5p	CLIP-seq
MIRT781422	hsa-miR-570	CLIP-seq
MIRT781423	hsa-miR-580	CLIP-seq
MIRT781424	hsa-miR-582-3p	CLIP-seq
MIRT781425	hsa-miR-603	CLIP-seq
MIRT2441939	hsa-miR-204	CLIP-seq
MIRT2441940	hsa-miR-211	CLIP-seq
MIRT2441941	hsa-miR-214	CLIP-seq
MIRT2441942	hsa-miR-3619-5p	CLIP-seq
MIRT2441943	hsa-miR-4291	CLIP-seq
MIRT2441944	hsa-miR-4659a-3p	CLIP-seq
MIRT2441945	hsa-miR-4659b-3p	CLIP-seq
MIRT2441946	hsa-miR-4755-5p	CLIP-seq
MIRT2441947	hsa-miR-623	CLIP-seq
MIRT2441948	hsa-miR-761	CLIP-seq
MIRT2441949	hsa-miR-922	CLIP-seq
MIRT2473895	hsa-miR-1243	CLIP-seq
MIRT781405	hsa-miR-1287	CLIP-seq
MIRT781406	hsa-miR-137	CLIP-seq
MIRT2473896	hsa-miR-23a	CLIP-seq
MIRT2473897	hsa-miR-23b	CLIP-seq
MIRT2473898	hsa-miR-23c	CLIP-seq
MIRT781411	hsa-miR-3135b	CLIP-seq
MIRT2473899	hsa-miR-3143	CLIP-seq
MIRT781400	hsa-miR-3163	CLIP-seq
MIRT2473900	hsa-miR-3164	CLIP-seq
MIRT781413	hsa-miR-3202	CLIP-seq
MIRT2473901	hsa-miR-337-5p	CLIP-seq
MIRT781414	hsa-miR-338-5p	CLIP-seq
MIRT2473902	hsa-miR-3611	CLIP-seq
MIRT2473903	hsa-miR-3654	CLIP-seq
MIRT2473904	hsa-miR-371-5p	CLIP-seq
MIRT2473905	hsa-miR-4257	CLIP-seq
MIRT781418	hsa-miR-4533	CLIP-seq
MIRT2473906	hsa-miR-4680-5p	CLIP-seq
MIRT2473907	hsa-miR-4695-5p	CLIP-seq
MIRT2473908	hsa-miR-4712-3p	CLIP-seq
MIRT2473909	hsa-miR-4753-3p	CLIP-seq
MIRT2473910	hsa-miR-4766-5p	CLIP-seq
MIRT2473911	hsa-miR-4789-3p	CLIP-seq
MIRT2473912	hsa-miR-4799-5p	CLIP-seq
MIRT2473913	hsa-miR-513a-3p	CLIP-seq
MIRT2473914	hsa-miR-543	CLIP-seq
MIRT2473915	hsa-miR-548b-3p	CLIP-seq
MIRT2473916	hsa-miR-548l	CLIP-seq
MIRT2473917	hsa-miR-548n	CLIP-seq
MIRT2473918	hsa-miR-548u	CLIP-seq
MIRT2473919	hsa-miR-581	CLIP-seq
MIRT2473920	hsa-miR-593	CLIP-seq
MIRT2473921	hsa-miR-606	CLIP-seq
MIRT2473922	hsa-miR-617	CLIP-seq
MIRT2473923	hsa-miR-642b	CLIP-seq
MIRT2473924	hsa-miR-885-5p	CLIP-seq
MIRT2473925	hsa-miR-888	CLIP-seq
MIRT2473895	hsa-miR-1243	CLIP-seq
MIRT2674983	hsa-miR-1257	CLIP-seq
MIRT781405	hsa-miR-1287	CLIP-seq
MIRT2674984	hsa-miR-1305	CLIP-seq
MIRT781406	hsa-miR-137	CLIP-seq
MIRT2674985	hsa-miR-144	CLIP-seq
MIRT2674986	hsa-miR-19a	CLIP-seq
MIRT2674987	hsa-miR-19b	CLIP-seq
MIRT2473896	hsa-miR-23a	CLIP-seq
MIRT2473897	hsa-miR-23b	CLIP-seq
MIRT2473898	hsa-miR-23c	CLIP-seq
MIRT781411	hsa-miR-3135b	CLIP-seq
MIRT2473899	hsa-miR-3143	CLIP-seq
MIRT781400	hsa-miR-3163	CLIP-seq
MIRT2473900	hsa-miR-3164	CLIP-seq
MIRT781413	hsa-miR-3202	CLIP-seq
MIRT2473901	hsa-miR-337-5p	CLIP-seq
MIRT781414	hsa-miR-338-5p	CLIP-seq
MIRT2473902	hsa-miR-3611	CLIP-seq
MIRT2473903	hsa-miR-3654	CLIP-seq
MIRT2473904	hsa-miR-371-5p	CLIP-seq
MIRT2674988	hsa-miR-3977	CLIP-seq
MIRT2473905	hsa-miR-4257	CLIP-seq
MIRT781418	hsa-miR-4533	CLIP-seq
MIRT2674989	hsa-miR-4670-3p	CLIP-seq
MIRT2473906	hsa-miR-4680-5p	CLIP-seq
MIRT2473907	hsa-miR-4695-5p	CLIP-seq
MIRT2674990	hsa-miR-4698	CLIP-seq
MIRT2674991	hsa-miR-4709-5p	CLIP-seq
MIRT2473908	hsa-miR-4712-3p	CLIP-seq
MIRT2473909	hsa-miR-4753-3p	CLIP-seq
MIRT2473910	hsa-miR-4766-5p	CLIP-seq
MIRT2473911	hsa-miR-4789-3p	CLIP-seq
MIRT2473912	hsa-miR-4799-5p	CLIP-seq
MIRT2473913	hsa-miR-513a-3p	CLIP-seq
MIRT2473914	hsa-miR-543	CLIP-seq
MIRT2473915	hsa-miR-548b-3p	CLIP-seq
MIRT2473916	hsa-miR-548l	CLIP-seq
MIRT2473917	hsa-miR-548n	CLIP-seq
MIRT2473918	hsa-miR-548u	CLIP-seq
MIRT2473919	hsa-miR-581	CLIP-seq
MIRT2473920	hsa-miR-593	CLIP-seq
MIRT2473921	hsa-miR-606	CLIP-seq
MIRT2674992	hsa-miR-607	CLIP-seq
MIRT2473922	hsa-miR-617	CLIP-seq
MIRT2473923	hsa-miR-642b	CLIP-seq
MIRT2473924	hsa-miR-885-5p	CLIP-seq
MIRT2473925	hsa-miR-888	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
ING4	Repression	20707719

Show/Hide all(69)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001568	Process	Blood vessel development	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001936	Process	Regulation of endothelial cell proliferation	IDA	8980223
GO:0002040	Process	Sprouting angiogenesis	IDA	9560344, 10218485
GO:0002092	Process	Positive regulation of receptor internalization	IDA	19424712
GO:0002719	Process	Negative regulation of cytokine production involved in immune response	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	20708158, 25814554, 29106382
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8980223, 10218485
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IDA	19424712
GO:0005902	Component	Microvillus	IDA	19424712
GO:0007162	Process	Negative regulation of cell adhesion	IDA	19674970
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007171	Process	Activation of transmembrane receptor protein tyrosine kinase activity	IDA	19424712
GO:0007596	Process	Blood coagulation	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	12958144
GO:0010628	Process	Positive regulation of gene expression	IMP	19148554
GO:0014842	Process	Regulation of skeletal muscle satellite cell proliferation	IDA	19733541
GO:0030097	Process	Hemopoiesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030195	Process	Negative regulation of blood coagulation	IDA	10761923
GO:0030195	Process	Negative regulation of blood coagulation	TAS	15005336
GO:0030210	Process	Heparin proteoglycan biosynthetic process	IDA	19297368
GO:0030971	Function	Receptor tyrosine kinase binding	IBA
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	8980223, 19922791
GO:0031012	Component	Extracellular matrix	IBA
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	19689429
GO:0031589	Process	Cell-substrate adhesion	IEA
GO:0032680	Process	Regulation of tumor necrosis factor production	IEA
GO:0034394	Process	Protein localization to cell surface	IDA	19615361
GO:0042308	Process	Negative regulation of protein import into nucleus	IEA
GO:0042802	Function	Identical protein binding	IPI	29106382
GO:0043066	Process	Negative regulation of apoptotic process	IDA	10218485, 12958144
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043116	Process	Negative regulation of vascular permeability	IDA	14978158, 19297368
GO:0043116	Process	Negative regulation of vascular permeability	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	9660821
GO:0045121	Component	Membrane raft	IDA	19615361
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:0048014	Process	Tie signaling pathway	IBA
GO:0048014	Process	Tie signaling pathway	IDA	19689429, 19922791
GO:0048014	Process	Tie signaling pathway	NAS	19148554
GO:0048018	Function	Receptor ligand activity	IDA	29323190
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	15851516, 19689429
GO:0050820	Process	Positive regulation of coagulation	IDA	29323190
GO:0050918	Process	Positive chemotaxis	IDA	9660821
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	18425120
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	19615361
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	18425120
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	19615361
GO:0072012	Process	Glomerulus vasculature development	IEA
GO:0072012	Process	Glomerulus vasculature development	ISS
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IMP	19148554
GO:1905605	Process	Positive regulation of blood-brain barrier permeability	IMP	19148554
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	19674970
GO:2000446	Process	Regulation of macrophage migration inhibitory factor signaling pathway	IEA

MIM	HGNC	e!Ensembl
601667	484	ENSG00000154188

Protein

UniProt ID

Q15389

Protein name

Angiopoietin-1 (ANG-1)

Protein function

Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorgan

PDB

4EPU , 4JYO , 4K0V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00147	Fibrinogen_C	282 → 496	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

Sequence

MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRA
TTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
GPSYSLRSTTMMIRPLDF

Sequence length

498

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway HIF-1 signaling pathway PI3K-Akt signaling pathway Rheumatoid arthritis		Tie2 Signaling RAF/MAP kinase cascade

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Angioedema	angioedema, hereditary, 5	N/A	N/A	GenCC
Congenital glaucoma	primary congenital glaucoma	N/A	N/A	GenCC
Glaucoma	glaucoma, Glaucoma	N/A	N/A	GenCC, GWAS

Show/Hide Text Mining Associations (122)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Kidney Injury	Associate	32680471
Adenocarcinoma	Inhibit	17785951
Adenocarcinoma of Lung	Inhibit	22048948
Adenocarcinoma of Lung	Associate	32669531, 34039311
Alzheimer Disease	Associate	39394418
Angioedemas Hereditary	Associate	32578786, 33593719, 33799813, 36787826
Arthritis	Associate	12525377
Arthritis Juvenile	Associate	20722033
Arthritis Rheumatoid	Associate	12010571, 12525377
Atherosclerosis	Associate	26283334
Autoimmune Diseases	Associate	20722033
Blood Loss Surgical	Associate	11891175
Breast Neoplasms	Associate	23232696, 27703260, 28045923, 29959560, 31619709, 31642813, 34685578, 35617355, 37176055, 39302921
Bronchopulmonary Dysplasia	Associate	18420967, 31967847
Carcinogenesis	Associate	15517881, 24404127
Carcinoma Hepatocellular	Associate	14600132, 16830384, 36157115
Carcinoma Mucoepidermoid	Associate	21948244
Carcinoma Renal Cell	Associate	17505508
Carcinoma Transitional Cell	Associate	15517881
Cartilage Diseases	Associate	16565972
Cataract	Stimulate	32180680
Cerebrovascular Disorders	Associate	28476896
Chondrosarcoma	Associate	16565972
Colonic Neoplasms	Associate	17785951
Colorectal Neoplasms	Associate	22496856, 22728324, 33573134
COVID 19	Associate	35405523
Dermatitis	Stimulate	33481042
Dermatitis Atopic	Associate	39245941
Diabetes Mellitus	Associate	26120272
Diabetes Mellitus	Inhibit	35932065
Diabetes Mellitus Type 2	Stimulate	35549955
Diabetic Angiopathies	Associate	31828164
Diabetic Foot	Associate	36232122
Diabetic Retinopathy	Associate	37249455
Disease Progression	Inhibit	34193611
Ectodermal Dysplasia	Associate	35628389
Endometrial Neoplasms	Associate	18644593
Endometriosis	Associate	18644593
Febrile Neutropenia	Associate	20509945
Fibrosis	Inhibit	32582222
Gastrointestinal Stromal Tumors	Associate	17724803
Glaucoma	Associate	32606567
Glioblastoma	Associate	9811337
Glioma	Associate	17189382, 34162919
Glomerulonephritis Membranous	Associate	26120272
Head and Neck Neoplasms	Associate	26171937
Heart Failure	Associate	31795484
Hemangiosarcoma	Associate	10854238, 23558570
Hemolytic Uremic Syndrome	Associate	23801605
Hemorrhage	Associate	20233519
Hyperglycemia	Associate	31828164
Hyperplasia	Associate	11436038
Hypertension	Associate	19218192
Hypertension Pulmonary	Stimulate	11436038
Hypertension Pulmonary	Associate	12571257, 34326408
Hypertrophy	Associate	11436038
Hypoxia	Inhibit	12213726
Hypoxia	Associate	30867055, 32351020, 35799115
IgA Vasculitis	Associate	17599743
Infarction Anterior Cerebral Artery	Associate	35628389
Inflammation	Associate	26283334
Inflammation	Inhibit	32582222
Intervertebral Disc Degeneration	Associate	28394321
Intracranial Arteriovenous Malformations	Associate	11463715
Ischemia	Associate	36232122
Keloid	Associate	25369801
Kidney Failure Chronic	Inhibit	34193611
Leukemia Megakaryoblastic Acute	Associate	9233584
Leukemia Myeloid Acute	Associate	23919981, 25605239, 26802051, 29286103
Liver Cirrhosis Biliary	Associate	17599743
Lupus Erythematosus Systemic	Associate	38162654
Lymphoma Follicular	Stimulate	33881493
Lymphoma Primary Effusion	Stimulate	25631079
Lymphoma T Cell	Associate	19120365
Malaria	Associate	23383853
Malaria Cerebral	Associate	23383853
Mastocytosis	Associate	33687603
Menorrhagia	Associate	11891175, 19406397
Mesothelioma Malignant	Associate	27509983
Multiple Myeloma	Associate	12649156
Multiple Myeloma	Stimulate	12930383
Multiple Myeloma	Inhibit	24355943
Multiple Sclerosis	Associate	30134823
Myelodysplastic Syndromes	Associate	21878936, 26802051
Myopia	Associate	32180680
Nasal Polyps	Associate	36304979
Neoplasm Metastasis	Associate	19916173, 37176055
Neoplasms	Associate	10506510, 15517881, 15816535, 16614513, 17724803, 23232696, 24341512, 25482628, 26044849, 26171937, 26686201, 27703260, 31642813, 33573134, 33713666 View all (5 more)
Neurilemmoma	Associate	17724803
Neuroendocrine Tumors	Associate	27994516
Neurofibroma Plexiform	Associate	21703400
Obesity	Associate	31640116
Ossification Heterotopic	Associate	18319563
Ossification of the posterior longitudinal ligament of the spine	Associate	18319563
Osteosarcoma	Associate	20340016
Ovarian Neoplasms	Stimulate	11071270
Ovarian Neoplasms	Associate	33713666
Pancreatic Neoplasms	Associate	21729304, 24341512
Peripheral Arterial Disease	Associate	24157526, 29876944
Plasmacytoma anaplastic	Stimulate	12930383
Post Acute COVID 19 Syndrome	Associate	37301958
Pre Eclampsia	Associate	36088594
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	19016730
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	21878936
Prostatic Neoplasms	Associate	30361641, 30866453
Psoriasis	Stimulate	11348459
Pulmonary Edema	Associate	26590154
Renal Insufficiency Chronic	Inhibit	23409162
Retinopathy of Prematurity	Inhibit	31266060
Sarcoma Kaposi	Associate	10854238, 25631079
Scleroderma Systemic	Associate	39515460
Sepsis	Associate	20509945
Shock	Associate	30286031
Shock Septic	Associate	20509945
Skin Neoplasms	Inhibit	20072135
Stomach Neoplasms	Associate	16614513, 19916173
Thyroid Cancer Papillary	Stimulate	23663694
Urinary Bladder Neoplasms	Associate	15517881
Uterine Hemorrhage	Associate	20233519
Vascular Diseases	Associate	23801605, 32680471
Vascular Remodeling	Inhibit	32582222
Weight Loss	Inhibit	23401397

ANGPT1 (angiopoietin 1)