Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
283989
Gene name Gene Name - the full gene name approved by the HGNC.
TRNA splicing endonuclease subunit 54
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TSEN54
Synonyms (NCBI Gene) Gene synonyms aliases
PCH2A, PCH4, PCH5, SEN54L, sen54
Disease Acronyms (UniProt) Disease acronyms from UniProt database
PCH2A, PCH4, PCH5
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a subunit of the tRNA splicing endonuclease complex, which catalyzes the removal of introns from precursor tRNAs. The complex is also implicated in pre-mRNA 3-prime end processing. Mutations in this gene result in pontocerebellar hypopla
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs113994152 G>T Pathogenic, pathogenic-likely-pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs113994153 C>T Pathogenic Coding sequence variant, stop gained
rs113994154 C>T Pathogenic Coding sequence variant, stop gained
rs143604970 A>C,T Likely-pathogenic Coding sequence variant, stop gained, missense variant
rs587784475 G>C,T Pathogenic Coding sequence variant, missense variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022257 hsa-miR-124-3p Microarray 18668037
MIRT042278 hsa-miR-484 CLASH 23622248
MIRT458058 hsa-miR-6510-5p PAR-CLIP 23592263
MIRT458057 hsa-miR-9500 PAR-CLIP 23592263
MIRT458056 hsa-miR-6760-5p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000214 Component TRNA-intron endonuclease complex IBA 21873635
GO:0000379 Process TRNA-type intron splice site recognition and cleavage IBA 21873635
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005654 Component Nucleoplasm TAS
GO:0005730 Component Nucleolus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608755 27561 ENSG00000182173
Protein
UniProt ID Q7Z6J9
Protein name tRNA-splicing endonuclease subunit Sen54 (SEN54 homolog) (HsSEN54) (tRNA-intron endonuclease Sen54)
Protein function Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an
PDB 7UXA , 7ZRZ , 8HMY , 8HMZ , 8ISS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12928 tRNA_int_end_N2 63 130 tRNA-splicing endonuclease subunit sen54 N-term Domain
Sequence
MEPEPEPAAVEVPAGRVLSARELFAARSRSQKLPQRSHGPKDFLPDGSAAQAERLRRCRE
ELWQLLAEQRVERLGSLVAAEWRPEEGFVELKSPAGKFWQTMGFSEQGRQRLHPEEALYL
LECGSIHLFH
QDLPLSIQEAYQLLLTDHTVTFLQYQVFSHLKRLGYVVRRFQPSSVLSPY
ERQLNLDASVQHLEDGDGKRKRSSSSPRSINKKAKALDNSLQPKSLAASSPPPCSQPSQC
PEEKPQESSPMKGPGGPFQLLGSLGPSPGPAREGVGCSWESGRAENGVTGAGKRRWNFEQ
ISFPNMASDSRHTLLRAPAPELLPANVAGRETDAESWCQKLNQRKEKLSRREREHHAEAA
QFQEDVNADPEVQRCSSWREYKELLQRRQVQRSQRRAPHLWGQPVTPLLSPGQASSPAVV
LQHISVLQTTHLPDGGARLLEKSGGLEIIFDVYQADAVATFRKNNPGKPYARMCISGFDE
PVPDLCSLKRLSYQSGDVPLIFALVDHGDISFYSFRDFTLPQDVGH
Sequence length 526
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    tRNA processing in the nucleus
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthrogryposis multiplex congenita Arthrogryposis rs1586285494, rs80358233, rs137853305, rs1559154278, rs398124167, rs398124172, rs587780399, rs786204576, rs786204430, rs769345284, rs749355583, rs793888524, rs793888525, rs878854368, rs555445835
View all (138 more)
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Mental retardation Profound Mental Retardation, Mental deficiency, Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
18711368
Microcephaly Microcephaly rs397704721, rs267607176, rs267607177, rs397704725, rs267606717, rs267606718, rs199422202, rs121434311, rs199422203, rs199422126, rs387906274, rs121434305, rs199422125, rs199422135, rs189678019
View all (280 more)
18711368
Unknown
Disease term Disease name Evidence References Source
Congenital contracture Congenital contracture ClinVar
Cerebellar Hypoplasia pontocerebellar hypoplasia type 5 GenCC
Associations from Text Mining
Disease Name Relationship Type References
Atrophy Associate 26701950
Carcinoma Hepatocellular Stimulate 37059591
Cerebellar Hypoplasia Associate 26701950
Death Associate 20952379
Dyskinesia Drug Induced Associate 20952379, 26701950
Dystonia Associate 20952379
Dystonic Disorders Associate 24886362
Hearing Loss Sensorineural Associate 32697043
Heart Defects Congenital Associate 32697043
Microcephaly Associate 26701950