Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2837
Gene name Gene Name - the full gene name approved by the HGNC.	Urotensin 2 receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UTS2R
Synonyms (NCBI Gene) Gene synonyms aliases	GPR14, UR-2-R, UTR, UTR2
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.3

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001604	Function	Urotensin II receptor activity	IBA
GO:0001604	Function	Urotensin II receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	10499587
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10499587
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0008015	Process	Blood circulation	IEA
GO:0008015	Process	Blood circulation	TAS	10499587
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8666380
GO:0097746	Process	Blood vessel diameter maintenance	IEA

MIM	HGNC	e!Ensembl
600896	4468	ENSG00000181408

Protein

UniProt ID

Q9UKP6

Protein name

Urotensin-2 receptor (UR-2-R) (G-protein coupled receptor 14) (Urotensin II receptor) (UR-II-R)

Protein function

High affinity receptor for urotensin-2 and urotensin-2B. The activity of this receptor is mediated by a G-protein that activate a phosphatidylinositol-calcium second messenger system.

PDB

6HVK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	68 → 315	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Most abundant expression in the heart and pancreas.

Sequence

MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSA
MGVVGVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGD
VGCRVLFGLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLL
TLPVMLAMRLVRRGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRR
SQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLT
TCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLS
SCSPQPTDSLVLAPAAPARPAPEGPRAPA

Sequence length

389

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Peptide ligand-binding receptors G alpha (q) signalling events

UTS2R (urotensin 2 receptor)