Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
283635
Gene name Gene Name - the full gene name approved by the HGNC.
Family with sequence similarity 177 member A1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FAM177A1
Synonyms (NCBI Gene) Gene synonyms aliases
C14orf24, NEDWMG
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a conserved protein family. Alternative splicing results in multiple transcript variants. This gene is thought to be associated with susceptibility to juvenile idiopathic arthritis. [provided by RefSeq, Apr 2017]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs730882244 ->A Likely-pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020986 hsa-miR-155-5p Reporter assay;Other 20584899
MIRT021622 hsa-miR-142-3p Microarray 17612493
MIRT002702 hsa-miR-124-3p Microarray 18668037
MIRT002702 hsa-miR-124-3p Microarray 15685193
MIRT045179 hsa-miR-186-5p CLASH 23622248
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
619181 19829 ENSG00000151327
Protein
UniProt ID Q8N128
Protein name Protein FAM177A1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14774 FAM177 39 154 FAM177 family Family
Sequence
MDQEPVGGVERGEAVAASGAAAAAAFGESAGQMSNERGFENVELGVIGKKKKVPRRVIHF
VSGETMEEYSTDEDEVDGLEKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEK
IASVLGISTPKYQYAIDEYYRMKKEEEEEEEENR
MSEEAEKQYQQNKLQTDSIVQTDQPE
TVISSSFVNVNFEMEGDSEVIMESKQNPVSVPP
Sequence length 213
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Dermatitis Dermatitis, Atopic rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 26482879
Psoriasis Psoriasis rs281875215, rs587777763, rs281875213, rs281875212 26974007
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
29121268
Unknown
Disease term Disease name Evidence References Source
Crohn disease Crohn Disease 26974007 ClinVar
Neurodevelopmental Disorders complex neurodevelopmental disorder GenCC
Oligodendroglioma Oligodendroglioma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 29228969
Hepatitis C Associate 29228969
Liver Cirrhosis Biliary Inhibit 36825008