Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	283600
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 25 member 47
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC25A47
Synonyms (NCBI Gene) Gene synonyms aliases	C14orf68, HDCMP, HDMCP, HMFN1655
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of a large family of mitochondrial transporters. The nuclear-encoded carrier protein is embedded in the inner mitochondrial membrane. This member of the family is thought to be an uncoupling protein that uncouples mitochondrial

Show/Hide all(17)

miRTarBase ID	miRNA	Experiments
MIRT1357350	hsa-miR-1228	CLIP-seq
MIRT1357351	hsa-miR-329	CLIP-seq
MIRT1357352	hsa-miR-345	CLIP-seq
MIRT1357353	hsa-miR-3622a-3p	CLIP-seq
MIRT1357354	hsa-miR-3622b-3p	CLIP-seq
MIRT1357355	hsa-miR-362-3p	CLIP-seq
MIRT1357356	hsa-miR-4254	CLIP-seq
MIRT1357357	hsa-miR-4292	CLIP-seq
MIRT1357358	hsa-miR-4308	CLIP-seq
MIRT2624377	hsa-miR-138	CLIP-seq
MIRT2624378	hsa-miR-338-3p	CLIP-seq
MIRT2624379	hsa-miR-4456	CLIP-seq
MIRT2624380	hsa-miR-4530	CLIP-seq
MIRT2624381	hsa-miR-541	CLIP-seq
MIRT2624382	hsa-miR-646	CLIP-seq
MIRT2624383	hsa-miR-654-5p	CLIP-seq
MIRT2624384	hsa-miR-766	CLIP-seq

Show/Hide all(6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0006844	Process	Acyl carnitine transport	IBA	21873635
GO:0006865	Process	Amino acid transport	IBA	21873635
GO:0015227	Function	Acyl carnitine transmembrane transporter activity	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA
GO:1902616	Process	Acyl carnitine transmembrane transport	IEA

MIM	HGNC	e!Ensembl
609911	20115	ENSG00000140107

Protein

UniProt ID

Q6Q0C1

Protein name

Solute carrier family 25 member 47 (Hepatocellular carcinoma down-regulated mitochondrial carrier protein) (Mitochondrial NAD(+) transporter SLC25A47)

Protein function

Mitochondrial NAD(+) transporter that acts as a 'metabolic gate' in hepatic lipogenesis. Provides NAD(+) substrate to mitochondrial SIRT3 deacetylase and enables its NAD(+)-dependent activities in mitochondrial energy metabolism. This triggers d

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	1 → 83	Mitochondrial carrier protein	Family
PF00153	Mito_carr	94 → 210	Mitochondrial carrier protein	Family
PF00153	Mito_carr	214 → 305	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in liver. {ECO:0000269|PubMed:15322095, ECO:0000269|PubMed:36804859}.

Sequence

MDFVAGAIGGVCGVAVGYPLDTVKVRIQTEPKYTGIWHCVRDTYHRERVWGFYRGLSLPV
CTVSLVSSVSFGTYRHCLAHICRLRYGNPDAKPTKADITLSGCASGLVRVFLTSPTEVAK
VRLQTQTQAQKQQRRLSASGPLAVPPMCPVPPACPEPKYRGPLHCLATVAREEGLCGLYK
GSSALVLRDGHSFATYFLSYAVLCEWLSPAGHSRPDVPGVLVAGGCAGVLAWAVATPMDV
IKSRLQADGQGQRRYRGLLHCMVTSVREEGPRVLFKGLVLNCCRAFPVNMVVFVAYEAVL
RLARGLLT

Sequence length

308

Interactions

View interactions

SLC25A47 (solute carrier family 25 member 47)