Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	283514
Gene name	Siah E3 ubiquitin protein ligase family member 3
Gene symbol	SIAH3
Synonyms (NCBI Gene)	-
Chromosome	13
Chromosome location	13q14.13

120

Show/Hide all (120)

miRTarBase ID	miRNA	Experiments	Reference
MIRT644104	hsa-miR-5193	HITS-CLIP	23824327
MIRT644103	hsa-miR-4324	HITS-CLIP	23824327
MIRT644102	hsa-miR-544b	HITS-CLIP	23824327
MIRT644101	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT644100	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT644099	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT644098	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT644097	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT644096	hsa-miR-3670	HITS-CLIP	23824327
MIRT644095	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT644094	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT644093	hsa-miR-1200	HITS-CLIP	23824327
MIRT644092	hsa-miR-502-5p	HITS-CLIP	23824327
MIRT644091	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT527330	hsa-miR-6507-5p	PAR-CLIP	22012620
MIRT527329	hsa-miR-4428	PAR-CLIP	22012620
MIRT527328	hsa-miR-1253	PAR-CLIP	22012620
MIRT527326	hsa-miR-4434	PAR-CLIP	22012620
MIRT527327	hsa-miR-4516	PAR-CLIP	22012620
MIRT527325	hsa-miR-5703	PAR-CLIP	22012620
MIRT527324	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT644104	hsa-miR-5193	HITS-CLIP	23824327
MIRT644103	hsa-miR-4324	HITS-CLIP	23824327
MIRT644102	hsa-miR-544b	HITS-CLIP	23824327
MIRT644101	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT644100	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT644099	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT644098	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT644097	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT644096	hsa-miR-3670	HITS-CLIP	23824327
MIRT644095	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT644094	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT644093	hsa-miR-1200	HITS-CLIP	23824327
MIRT644092	hsa-miR-502-5p	HITS-CLIP	23824327
MIRT644091	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT527330	hsa-miR-6507-5p	PAR-CLIP	22012620
MIRT527329	hsa-miR-4428	PAR-CLIP	22012620
MIRT527328	hsa-miR-1253	PAR-CLIP	22012620
MIRT527326	hsa-miR-4434	PAR-CLIP	22012620
MIRT527327	hsa-miR-4516	PAR-CLIP	22012620
MIRT527325	hsa-miR-5703	PAR-CLIP	22012620
MIRT527324	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT1348282	hsa-miR-1184	CLIP-seq
MIRT1348283	hsa-miR-1224-5p	CLIP-seq
MIRT739349	hsa-miR-1265	CLIP-seq
MIRT1348284	hsa-miR-1273f	CLIP-seq
MIRT1348285	hsa-miR-129-5p	CLIP-seq
MIRT1348286	hsa-miR-1343	CLIP-seq
MIRT1348287	hsa-miR-138	CLIP-seq
MIRT1348288	hsa-miR-2278	CLIP-seq
MIRT1348289	hsa-miR-3180-5p	CLIP-seq
MIRT1348290	hsa-miR-3652	CLIP-seq
MIRT1348291	hsa-miR-378g	CLIP-seq
MIRT1348292	hsa-miR-4418	CLIP-seq
MIRT1348293	hsa-miR-4430	CLIP-seq
MIRT1348294	hsa-miR-4437	CLIP-seq
MIRT1348295	hsa-miR-4443	CLIP-seq
MIRT1348296	hsa-miR-4505	CLIP-seq
MIRT1348297	hsa-miR-450a	CLIP-seq
MIRT1348298	hsa-miR-4649-3p	CLIP-seq
MIRT1348299	hsa-miR-4674	CLIP-seq
MIRT739350	hsa-miR-4700-3p	CLIP-seq
MIRT1348300	hsa-miR-4714-3p	CLIP-seq
MIRT1348301	hsa-miR-4751	CLIP-seq
MIRT1348302	hsa-miR-4756-3p	CLIP-seq
MIRT1348303	hsa-miR-4775	CLIP-seq
MIRT1348304	hsa-miR-4779	CLIP-seq
MIRT1348305	hsa-miR-500a	CLIP-seq
MIRT1348306	hsa-miR-501-5p	CLIP-seq
MIRT1348307	hsa-miR-509-3-5p	CLIP-seq
MIRT1348308	hsa-miR-509-3p	CLIP-seq
MIRT739351	hsa-miR-5095	CLIP-seq
MIRT1348309	hsa-miR-509-5p	CLIP-seq
MIRT1348310	hsa-miR-520a-5p	CLIP-seq
MIRT1348311	hsa-miR-525-5p	CLIP-seq
MIRT1348312	hsa-miR-548q	CLIP-seq
MIRT1348313	hsa-miR-590-3p	CLIP-seq
MIRT1348314	hsa-miR-765	CLIP-seq
MIRT2103201	hsa-miR-1208	CLIP-seq
MIRT2103202	hsa-miR-1237	CLIP-seq
MIRT2103203	hsa-miR-1248	CLIP-seq
MIRT2103204	hsa-miR-145	CLIP-seq
MIRT2103205	hsa-miR-2355-5p	CLIP-seq
MIRT1348290	hsa-miR-3652	CLIP-seq
MIRT2103206	hsa-miR-3663-5p	CLIP-seq
MIRT2103207	hsa-miR-371-5p	CLIP-seq
MIRT2103208	hsa-miR-371b-5p	CLIP-seq
MIRT2103209	hsa-miR-3925-3p	CLIP-seq
MIRT2103210	hsa-miR-4277	CLIP-seq
MIRT1348293	hsa-miR-4430	CLIP-seq
MIRT2103211	hsa-miR-4448	CLIP-seq
MIRT2103212	hsa-miR-4659a-3p	CLIP-seq
MIRT2103213	hsa-miR-4659b-3p	CLIP-seq
MIRT2103214	hsa-miR-4747-5p	CLIP-seq
MIRT2103215	hsa-miR-4778-3p	CLIP-seq
MIRT2103216	hsa-miR-515-5p	CLIP-seq
MIRT2103217	hsa-miR-581	CLIP-seq
MIRT2103218	hsa-miR-766	CLIP-seq
MIRT2103219	hsa-miR-942	CLIP-seq
MIRT2327478	hsa-miR-1185	CLIP-seq
MIRT1348283	hsa-miR-1224-5p	CLIP-seq
MIRT2327479	hsa-miR-3065-3p	CLIP-seq
MIRT2327480	hsa-miR-338-3p	CLIP-seq
MIRT2327481	hsa-miR-3605-5p	CLIP-seq
MIRT2327482	hsa-miR-3663-3p	CLIP-seq
MIRT2327483	hsa-miR-3679-5p	CLIP-seq
MIRT2327484	hsa-miR-3915	CLIP-seq
MIRT2327485	hsa-miR-4461	CLIP-seq
MIRT2327486	hsa-miR-4689	CLIP-seq
MIRT1348300	hsa-miR-4714-3p	CLIP-seq
MIRT2327487	hsa-miR-512-5p	CLIP-seq
MIRT2459348	hsa-miR-1182	CLIP-seq
MIRT2459349	hsa-miR-1267	CLIP-seq
MIRT2459350	hsa-miR-3135b	CLIP-seq
MIRT1348290	hsa-miR-3652	CLIP-seq
MIRT2459351	hsa-miR-3664-5p	CLIP-seq
MIRT2459352	hsa-miR-4423-5p	CLIP-seq
MIRT1348293	hsa-miR-4430	CLIP-seq
MIRT2459353	hsa-miR-4639-3p	CLIP-seq
MIRT1348285	hsa-miR-129-5p	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	24270810
GO:0005739	Component	Mitochondrion	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IBA
GO:0031647	Process	Regulation of protein stability	IMP	24270810
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:1903215	Process	Negative regulation of protein targeting to mitochondrion	IDA	24270810

MIM	HGNC	e!Ensembl
615609	30553	ENSG00000215475

Q8IW03

Protein name

Seven in absentia homolog 3 (Siah-3)

Protein function

Negative regulator of PRKN translocation to damaged mitochondria. Acts probably by destabilizing PINK1 protein, hence inhibiting PRKN targeting to dysfunctional depolarized mitochondria.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03145	Sina	79 → 256	Seven in absentia protein family	Family

Sequence

MLFFTQCFGAVLDLIHLRFQHYKAKRVFSAAGQLVCVVNPTHNLKYVSSRRAVTQSAPEQ
GSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEAGLHANPVTPCLCMCPLFSCQWEGRL
EVVVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHSCLGHHFLLVLRKQERHEGH
PQFFATMMLIGTPTQADCFTYRLELNRNHRRLKWEATPRSVLECVDSVITDGDCLVLNTS
LAQLFSDNGSLAIGIAITATEVLPSEAEM

Sequence length

269

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Brain Diseases	Associate	31711042	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	40243415	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Associate	31711042	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Associate	31711042	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercapnia	Associate	40243415	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Associate	24270810	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	31711042	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	33517887	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phobia Social	Associate	33542190	★★★★★ ★☆☆☆☆ Found in Text Mining only

SIAH3 (siah E3 ubiquitin protein ligase family member 3)