Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	283461
Gene name	Regulator of DNA class I crossover intermediates 1
Gene symbol	REDIC1
Synonyms (NCBI Gene)	C12orf40HEIP1HEL-206HEL-S-94
Chromosome	12
Chromosome location	12q12

Show/Hide all (15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018817	hsa-miR-335-5p	Microarray	18185580
MIRT019425	hsa-miR-148b-3p	Microarray	17612493
MIRT023102	hsa-miR-124-3p	Microarray	18668037
MIRT024013	hsa-miR-1-3p	Microarray	18668037
MIRT1945943	hsa-miR-548ae	CLIP-seq
MIRT1945944	hsa-miR-548aj	CLIP-seq
MIRT1945945	hsa-miR-548am	CLIP-seq
MIRT1945946	hsa-miR-548x	CLIP-seq
MIRT1945947	hsa-miR-618	CLIP-seq
MIRT2184374	hsa-miR-1305	CLIP-seq
MIRT2184375	hsa-miR-3143	CLIP-seq
MIRT2184376	hsa-miR-3662	CLIP-seq
MIRT2184377	hsa-miR-421	CLIP-seq
MIRT2184378	hsa-miR-4307	CLIP-seq
MIRT2184379	hsa-miR-4699-3p	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005694	Component	Chromosome	IEA
GO:0051321	Process	Meiotic cell cycle	IEA

MIM	HGNC	e!Ensembl
620495	26846	ENSG00000180116

Q86WS4

Protein name

Regulator of DNA class I crossover intermediates 1

Protein function

Involved in recombination, probably acting by stabilizing recombination intermediates during meiotic crossover formation. Required for normal germline development and fertility. Required for meiotic progression, complete chromosomal synapsis and

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15089	DUF4552	229 → 652	Domain of unknown function (DUF4552)	Family

Sequence

MNWVGGSRSRVLIKQERRKQKEYFEKHRLKSKMKSLGVLSPVKNSAVSLDILNLYMVNQI
SCKKKIPETVRKPTHVNMNRDIKMPLRKHNLELTMSPHCVPSKLCLDDTETNVNCQRLSS
KEDLGPVQSQGMDSYSMLHPQFSKIENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQK
LAYEKKQNDQRSTVNCSDSLLSKLNKSQDVFSPSHKTTRFGTLFERLNSLGNRNLLTKSP
AVIMDEDCRSTDEIRQSDYITEKHSIQHIWGKNGKEVSNFLEDVNQSTPNLLSENCDSFV
SQNMINVLNIDEQRIKKTFNKCDYDSMGDTCVVTSSDKNHVTDRCIRNIFTVPELTFSNS
TLNKTSYPEKCQPNKKYQREYNKNERNDLSTSFENDYYPSSSERKEKFENDYQEKTPQKS
IQKYPANSMGNIPSEELHSKQSWDFGLDEILMEEGGIYSLKSKRISTKKISLDSAQSSRS
TSYSPRPTDSCFSSSSDLPSEDEDQISQQIEDSNRMTIKTKEKMNNFYVERMAKLSGDRI
VKNDDKIHKQNENFYQFSVKNNTDQFPQLQCNSAHILQNKTNDNCVLQAARCDAGIQTES
ESVMEEKLDVAIQCDLISKCTCRSDVSLCNLERCSGNIKADTTGGQEIHKNN

Sequence length

652

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Spermatogenic Failure	Pathogenic	rs746071945	RCV003228067	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

REDIC1 (regulator of DNA class I crossover intermediates 1)