PRLHR (prolactin releasing hormone receptor)

Gene

• Entrez ID: 2834
• Gene name: Prolactin releasing hormone receptor
• Gene symbol: PRLHR
• Synonyms (NCBI Gene): GPR10, GR3, PrRPR
• Chromosome: 10
• Chromosome location: 10q26.11
• Summary: PRLHR is a 7-transmembrane domain receptor for prolactin-releasing hormone (PRLH; MIM 602663) that is highly expressed in anterior pituitary (Ozawa et al., 2002 [PubMed 11923475]).[supplied by OMIM, Mar 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1263939	hsa-miR-3671	CLIP-seq
MIRT1263940	hsa-miR-374c	CLIP-seq
MIRT1263941	hsa-miR-4699-3p	CLIP-seq
MIRT1263942	hsa-miR-4708-3p	CLIP-seq
MIRT1263943	hsa-miR-607	CLIP-seq
MIRT1263944	hsa-miR-655	CLIP-seq
MIRT2304237	hsa-miR-186	CLIP-seq
MIRT2304238	hsa-miR-205	CLIP-seq
MIRT2304239	hsa-miR-2355-3p	CLIP-seq
MIRT2304240	hsa-miR-3133	CLIP-seq
MIRT2304241	hsa-miR-3945	CLIP-seq
MIRT2304242	hsa-miR-4646-3p	CLIP-seq
MIRT2304243	hsa-miR-4728-3p	CLIP-seq
MIRT2304244	hsa-miR-4761-3p	CLIP-seq
MIRT2304245	hsa-miR-676	CLIP-seq
MIRT2601155	hsa-miR-3664-3p	CLIP-seq
MIRT2304243	hsa-miR-4728-3p	CLIP-seq
MIRT2601156	hsa-miR-510	CLIP-seq
MIRT2601157	hsa-miR-512-5p	CLIP-seq
MIRT2601158	hsa-miR-550b	CLIP-seq
MIRT2601159	hsa-miR-873	CLIP-seq
MIRT2601155	hsa-miR-3664-3p	CLIP-seq
MIRT2304243	hsa-miR-4728-3p	CLIP-seq
MIRT2601156	hsa-miR-510	CLIP-seq
MIRT2601157	hsa-miR-512-5p	CLIP-seq
MIRT2601158	hsa-miR-550b	CLIP-seq
MIRT2601159	hsa-miR-873	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	8666380
GO:0004983	Function	Neuropeptide Y receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	11641419
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8666380
GO:0005929	Component	Cilium	IDA	28154160
GO:0005929	Component	Cilium	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8666380
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007565	Process	Female pregnancy	TAS	9607765
GO:0007631	Process	Feeding behavior	IEA
GO:0008188	Function	Neuropeptide receptor activity	IBA
GO:0008188	Function	Neuropeptide receptor activity	TAS	9607765
GO:0016020	Component	Membrane	IEA
GO:0042445	Process	Hormone metabolic process	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA

Other IDs

• MIM: 600895
• HGNC: 4464
• e!Ensembl: ENSG00000119973

Protein

• UniProt ID: P49683
• Protein name: Prolactin-releasing peptide receptor (PrRP receptor) (PrRPR) (G-protein coupled receptor 10) (hGR3)
• Protein function: Receptor for prolactin-releasing peptide (PrRP). Implicated in lactation, regulation of food intake and pain-signal processing.
• PDB: 8ZPS, 8ZPT, 9K26, 9K27
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	77 → 335	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Only detected in the pituitary gland and in all cell types of pituitary adenomas. {ECO:0000269|PubMed:10498338, ECO:0000269|PubMed:11923475}.
• Sequence:

  MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK
  GLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAY
  AFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAV
  LAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLV
  ILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLL
  RDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPH
  GQNMTVSVVI

• Sequence length: 370

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Peptide ligand-binding receptors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Alzheimer Disease	Associate	38067107	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Inhibit	26302849	★☆☆☆☆ Found in Text Mining only
limbic predominant age related TDP 43 encephalopathy	Inhibit	38067107	★☆☆☆☆ Found in Text Mining only