Gene Gene information from NCBI Gene database.
Entrez ID 283337
Gene name Zinc finger protein 740
Gene symbol ZNF740
Synonyms (NCBI Gene)
Zfp740
Chromosome 12
Chromosome location 12q13.13
miRNA miRNA information provided by mirtarbase database.
377
miRTarBase ID miRNA Experiments Reference
MIRT022178 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT651018 hsa-miR-605-5p HITS-CLIP 23824327
MIRT651017 hsa-miR-495-3p HITS-CLIP 23824327
MIRT651016 hsa-miR-5688 HITS-CLIP 23824327
MIRT651015 hsa-miR-7-1-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003700 Function DNA-binding transcription factor activity IBA
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620976 27465 ENSG00000139651
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NDX6
Protein name Zinc finger protein 740 (OriLyt TD-element-binding protein 7)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 101 123 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 129 151 Zinc finger, C2H2 type Domain
Sequence
MAQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSD
KSRSRKDDDSLSEASHSKKTVKKVVVVEQNGSFQVKIPKNFVCEHCFGAFRSSYHLKRHI
LIH
TGEKPFECDICDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQ
GCQSKTSDGQFSL
Sequence length 193
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway