CXCR3 (C-X-C motif chemokine receptor 3)

Gene

• Entrez ID: 2833
• Gene name: C-X-C motif chemokine receptor 3
• Gene symbol: CXCR3
• Synonyms (NCBI Gene): CD182, CD183, CKR-L2, CMKAR3, GPR9, IP10-R, Mig-R, MigR
• Chromosome: X
• Chromosome location: Xq13.1
• Summary: This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant)

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT734913	hsa-miR-34a-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, Flow cytometry, ELISA	33229509
MIRT918206	hsa-miR-15a	CLIP-seq
MIRT918207	hsa-miR-15b	CLIP-seq
MIRT918208	hsa-miR-16	CLIP-seq
MIRT918209	hsa-miR-1910	CLIP-seq
MIRT918210	hsa-miR-195	CLIP-seq
MIRT918211	hsa-miR-3173-3p	CLIP-seq
MIRT918212	hsa-miR-3908	CLIP-seq
MIRT918213	hsa-miR-424	CLIP-seq
MIRT918214	hsa-miR-4428	CLIP-seq
MIRT918215	hsa-miR-4521	CLIP-seq
MIRT918216	hsa-miR-497	CLIP-seq
MIRT918217	hsa-miR-3192	CLIP-seq
MIRT918218	hsa-miR-3689a-3p	CLIP-seq
MIRT918219	hsa-miR-3689c	CLIP-seq
MIRT918220	hsa-miR-4487	CLIP-seq
MIRT918221	hsa-miR-4532	CLIP-seq
MIRT918222	hsa-miR-4728-5p	CLIP-seq
MIRT1972150	hsa-miR-3174	CLIP-seq
MIRT1972151	hsa-miR-3907	CLIP-seq
MIRT1972152	hsa-miR-4271	CLIP-seq
MIRT1972153	hsa-miR-4283	CLIP-seq
MIRT1972154	hsa-miR-4489	CLIP-seq
MIRT1972155	hsa-miR-4725-3p	CLIP-seq
MIRT1972156	hsa-miR-4731-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TBX21	Activation	14500650;21540308

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IDA	12782716
GO:0002685	Process	Regulation of leukocyte migration	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	9064356
GO:0005515	Function	Protein binding	IPI	23170857, 26871637, 32296183
GO:0005737	Component	Cytoplasm	TAS	10903743
GO:0005886	Component	Plasma membrane	IDA	12782716
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9064356, 10741397
GO:0006915	Process	Apoptotic process	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10903763
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0007155	Process	Cell adhesion	TAS	10942362
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	11554781
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IMP	12782716
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	12782716
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	10903743
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	12782716
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	20608915
GO:0009986	Component	Cell surface	IEA
GO:0010818	Process	T cell chemotaxis	IEA
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016494	Function	C-X-C chemokine receptor activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	12782716
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0019956	Function	Chemokine binding	IPI	11554781
GO:0019957	Function	C-C chemokine binding	IBA
GO:0019958	Function	C-X-C chemokine binding	IDA	12782716
GO:0030155	Process	Regulation of cell adhesion	IDA	19703720
GO:0038023	Function	Signaling receptor activity	IDA	12782716
GO:0045766	Process	Positive regulation of angiogenesis	IDA	12782716
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12782716
GO:0050921	Process	Positive regulation of chemotaxis	IDA	12782716
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IMP	12782716
GO:0060326	Process	Cell chemotaxis	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:1900118	Process	Negative regulation of execution phase of apoptosis	IDA	12782716
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IDA	12782716

Other IDs

• MIM: 300574
• HGNC: 4540
• e!Ensembl: ENSG00000186810

Protein

• UniProt ID: P49682
• Protein name: C-X-C chemokine receptor type 3 (CXC-R3) (CXCR-3) (CKR-L2) (G protein-coupled receptor 9) (Interferon-inducible protein 10 receptor) (IP-10 receptor) (CD antigen CD183)
• Protein function: [Isoform 1]: Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells (HMC) through a heterotrimeric G-protein signaling pathway (PubMed:12782716). Binds
• PDB: 8HNK, 8HNL, 8HNM, 8HNN, 8K2W, 8K2X, 8XXY, 8XXZ, 8XYI, 8XYK, 8Y0H, 8Y0N
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	70 → 318	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta. Isoform 2 is expressed in endothelial cells. Expressed in T-cells (at protein level). {ECO:0000269|PubMe
• Sequence:

  MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALY
  SLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFG
  SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCL
  LFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILA
  VLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
  SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSET
  SEASYSGL

• Sequence length: 368

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events