CDH20 (cadherin 20)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
28316
Gene name Gene Name - the full gene name approved by the HGNC.
Cadherin 20
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CDH20
Synonyms (NCBI Gene) Gene synonyms aliases
CDH7L3, Cdh7
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q21.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a type II classical cadherin from the cadherin superfamily and one of three cadherin 7-like genes located in a cluster on chromosome 18. The encoded membrane protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five ext
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT016914 hsa-miR-335-5p Microarray 18185580
MIRT019298 hsa-miR-148b-3p Microarray 17612493
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0000902 Process Cell morphogenesis IBA 21873635
GO:0005509 Function Calcium ion binding IBA 21873635
GO:0005912 Component Adherens junction IBA 21873635
GO:0007043 Process Cell-cell junction assembly IBA 21873635
GO:0007156 Process Homophilic cell adhesion via plasma membrane adhesion molecules IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605807 1760 ENSG00000101542
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9HBT6
Protein name Cadherin-20
Protein function Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00028 Cadherin 64 → 156 Cadherin domain Domain
PF00028 Cadherin 170 → 265 Cadherin domain Domain
PF00028 Cadherin 279 → 381 Cadherin domain Domain
PF00028 Cadherin 394 → 485 Cadherin domain Domain
PF00028 Cadherin 498 → 595 Cadherin domain Domain
PF01049 Cadherin_C 643 → 794 Cadherin cytoplasmic region Family
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta, adult brain, and fetal brain.
Sequence 
MWTSGRMSNAKNWLGLGMSLYFWGLMDLTTTVLSDTPTPQGELEALLSDKPQSHQRTKRS
WVWNQFFVLEEYTGTDPLYVGKLHSDMDRGDGSIKYILSGEGAGIVFTIDDTTGDIHAIQ
RLDREERAQYTLRAQALDRRTGRPMEPESEFIIKIQDINDNEPKFLDGPYVATVPEMSPV
GTSVIQVTATDADDPTYGNSARVVYSILQGQPYFSVDSKTGVIRTALMNMDREAKEYYEV
IIQAKDMGGQLGGLAGTTTVNITLSDVNDNPPRFPQKHYQMSVLESAPISSTVGRVFAKD
LDEGINAEMKYTIVDGDGADAFDISTDPNFQVGIITVKKPLSFESKKSYTLKVEGANPHL
EMRFLNLGPFQDTTTVHISVEDVDEPPVFEPGFYFVEVPEDVAIGTTIQIISAKDPDVTN
NSIRYSIDRSSDPGRFFYVDITTGALMTARPLDREEFSWHNITVLAMEMNNPSQVGSVPV
TIKVLDVNDNAPEFPRFYEAFVCENAKAGQLIQTVSAVDQDDPRNGQHFYYSLAPEAANN
PNFTIRDNQDNTARILTRRSGFRQQEQSVFHLPILIADSGQPVLSSTGTLTIQVCSCDDD
GHVMSCSPEAYMLPVSLSRGALIAILACIFVLLVLVLLILSMRRHRKQPYIIDDEENIHE
NIVRYDDEGGGEEDTEAFDIAAMWNPREAQAGAAPKTRQDMLPEIESLSRYVPQTCAVNS
TVHSYVLAKLYEADMDLWAPPFDSLQTYMFEGDGSVAGSLSSLQSATSDSEQSFDFLTDW
GPRFRKLAELYGASEGPAPLW
Sequence length 801
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 21926974
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Alzheimer disease Alzheimer disease GWAS
Show/Hide Text Mining Associations (4)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 23301059
Adenoma Associate 23301059
Carcinogenesis Associate 23301059
Glioma Associate 32987560