Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	283
Gene name	Angiogenin
Gene symbol	ANG
Synonyms (NCBI Gene)	ALS9HEL168RAA1RNASE4RNASE5
Chromosome	14
Chromosome location	14q11.2
Summary	The protein encoded by this gene is a member of the RNase A superfamily though it has relatively weak ribonucleolytic activity. This protein is a potent mediator of new blood vessel formation and thus, in addition to the name RNase5, is commonly called an

Show/Hide all (86)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006649	hsa-miR-409-3p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	22531314
MIRT018344	hsa-miR-335-5p	Microarray	18185580
MIRT024617	hsa-miR-215-5p	Microarray	19074876
MIRT026610	hsa-miR-192-5p	Microarray	19074876
MIRT517273	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT517272	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT517271	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT707391	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT517270	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT607938	hsa-miR-6514-5p	HITS-CLIP	24906430
MIRT607937	hsa-miR-5693	HITS-CLIP	24906430
MIRT607936	hsa-miR-6812-3p	HITS-CLIP	24906430
MIRT607935	hsa-miR-4695-3p	HITS-CLIP	24906430
MIRT607934	hsa-miR-4534	HITS-CLIP	24906430
MIRT607933	hsa-miR-8082	HITS-CLIP	24906430
MIRT607932	hsa-miR-6499-3p	HITS-CLIP	24906430
MIRT607931	hsa-miR-3135b	HITS-CLIP	24906430
MIRT607930	hsa-miR-1289	HITS-CLIP	24906430
MIRT607929	hsa-miR-4294	HITS-CLIP	24906430
MIRT607928	hsa-miR-504-3p	HITS-CLIP	24906430
MIRT607927	hsa-miR-122-5p	HITS-CLIP	24906430
MIRT607926	hsa-miR-3652	HITS-CLIP	24906430
MIRT607925	hsa-miR-4430	HITS-CLIP	24906430
MIRT607924	hsa-miR-143-5p	HITS-CLIP	24906430
MIRT607923	hsa-miR-7641	HITS-CLIP	24906430
MIRT607922	hsa-miR-3198	HITS-CLIP	24906430
MIRT607921	hsa-miR-4309	HITS-CLIP	24906430
MIRT607920	hsa-miR-5698	HITS-CLIP	24906430
MIRT517273	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT517272	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT551227	hsa-miR-378j	PAR-CLIP	21572407
MIRT551226	hsa-miR-6839-5p	PAR-CLIP	21572407
MIRT517271	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT517270	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT517273	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT517272	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT517271	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT517270	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT497621	hsa-miR-1245b-5p	PAR-CLIP	22291592
MIRT497620	hsa-miR-3142	PAR-CLIP	22291592
MIRT497619	hsa-miR-3922-5p	PAR-CLIP	22291592
MIRT497618	hsa-miR-454-5p	PAR-CLIP	22291592
MIRT497617	hsa-miR-3927-5p	PAR-CLIP	22291592
MIRT497616	hsa-miR-4481	PAR-CLIP	22291592
MIRT497615	hsa-miR-4745-5p	PAR-CLIP	22291592
MIRT497614	hsa-miR-18b-3p	PAR-CLIP	22291592
MIRT497613	hsa-miR-1238-5p	PAR-CLIP	22291592
MIRT497612	hsa-miR-4758-5p	PAR-CLIP	22291592
MIRT497611	hsa-miR-4658	PAR-CLIP	22291592
MIRT497610	hsa-miR-6790-5p	PAR-CLIP	22291592
MIRT497609	hsa-miR-3157-3p	PAR-CLIP	22291592
MIRT497608	hsa-miR-874-3p	PAR-CLIP	22291592
MIRT517273	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT517272	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT517271	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT707391	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT517270	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT517273	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT517272	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT551227	hsa-miR-378j	PAR-CLIP	21572407
MIRT551226	hsa-miR-6839-5p	PAR-CLIP	21572407
MIRT517271	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT517270	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT517273	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT517272	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT517271	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT517270	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT497621	hsa-miR-1245b-5p	PAR-CLIP	22291592
MIRT497620	hsa-miR-3142	PAR-CLIP	22291592
MIRT497619	hsa-miR-3922-5p	PAR-CLIP	22291592
MIRT497618	hsa-miR-454-5p	PAR-CLIP	22291592
MIRT497617	hsa-miR-3927-5p	PAR-CLIP	22291592
MIRT497616	hsa-miR-4481	PAR-CLIP	22291592
MIRT497615	hsa-miR-4745-5p	PAR-CLIP	22291592
MIRT497614	hsa-miR-18b-3p	PAR-CLIP	22291592
MIRT497613	hsa-miR-1238-5p	PAR-CLIP	22291592
MIRT497612	hsa-miR-4758-5p	PAR-CLIP	22291592
MIRT497611	hsa-miR-4658	PAR-CLIP	22291592
MIRT497610	hsa-miR-6790-5p	PAR-CLIP	22291592
MIRT497609	hsa-miR-3157-3p	PAR-CLIP	22291592
MIRT497608	hsa-miR-874-3p	PAR-CLIP	22291592
MIRT781158	hsa-miR-3202	CLIP-seq
MIRT781159	hsa-miR-4533	CLIP-seq
MIRT781160	hsa-miR-4694-3p	CLIP-seq
MIRT781161	hsa-miR-922	CLIP-seq
MIRT781161	hsa-miR-922	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
CTCF	Unknown	24659782
PPARD	Repression	17511960

Show/Hide all (91)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IDA	8448182
GO:0001525	Process	Angiogenesis	IDA	3470787, 4074709
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IMP	2479414, 17125737
GO:0001525	Process	Angiogenesis	TAS	16567967
GO:0001541	Process	Ovarian follicle development	NAS	12770725
GO:0001556	Process	Oocyte maturation	NAS	11438326
GO:0001666	Process	Response to hypoxia	IDA	10999833, 15979542, 16490744
GO:0001666	Process	Response to hypoxia	NAS	15776477
GO:0001878	Process	Response to yeast	IDA	12548285
GO:0001890	Process	Placenta development	NAS	11984825
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	9122172, 9707554
GO:0002181	Process	Cytoplasmic translation	IDA	38718836
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IC	10649442
GO:0003677	Function	DNA binding	IEA
GO:0003779	Function	Actin binding	IDA	7679494, 11782452
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004519	Function	Endonuclease activity	TAS	10103013
GO:0004521	Function	RNA endonuclease activity	TAS
GO:0004540	Function	RNA nuclease activity	IBA
GO:0004540	Function	RNA nuclease activity	IDA	2424496, 2459697, 2730651, 3122207, 3289612, 3470787, 8159680, 8570639, 8622921, 11919285, 23047679
GO:0004540	Function	RNA nuclease activity	IEA
GO:0004549	Function	TRNA-specific ribonuclease activity	IDA	19332886, 20129916, 21855800, 27518564, 29100074, 29748193, 31582561, 32510170, 38718836
GO:0005102	Function	Signaling receptor binding	IDA	9122172
GO:0005507	Function	Copper ion binding	IDA	9245697
GO:0005515	Function	Protein binding	IPI	2742853, 3470787, 10413501, 15737636, 17991437, 24457100, 28514442, 28777577, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005604	Component	Basement membrane	IDA	15166501
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	3663649, 16461950, 16490744, 23047679, 29748193
GO:0005634	Component	Nucleus	IDA	23047679, 23843625
GO:0005634	Component	Nucleus	IDA	10649442, 15735021, 25372031
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005730	Component	Nucleolus	ISS
GO:0005737	Component	Cytoplasm	IDA	23047679, 23843625
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006898	Process	Receptor-mediated endocytosis	IDA	29100074
GO:0007154	Process	Cell communication	NAS	10103013
GO:0007165	Process	Signal transduction	IDA	29100074
GO:0008201	Function	Heparin binding	IDA	10103013
GO:0009303	Process	RRNA transcription	IDA	27518564, 29100074, 32510170
GO:0009303	Process	RRNA transcription	IMP	15735021
GO:0009725	Process	Response to hormone	IDA	10999833
GO:0010494	Component	Cytoplasmic stress granule	IDA	27518564, 29100074
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016078	Process	TRNA decay	TAS
GO:0016477	Process	Cell migration	IMP	17125737
GO:0016787	Function	Hydrolase activity	IEA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0019731	Process	Antibacterial humoral response	IDA	12548285
GO:0019732	Process	Antifungal humoral response	IDA	12548285
GO:0019843	Function	RRNA binding	TAS	2457905
GO:0023052	Process	Signaling	IDA	2457905
GO:0030041	Process	Actin filament polymerization	ISS
GO:0030139	Component	Endocytic vesicle	IDA	29748193
GO:0030154	Process	Cell differentiation	IEA
GO:0030426	Component	Growth cone	ISS
GO:0032055	Process	Negative regulation of translation in response to stress	IDA	19332886, 20129916, 21855800, 27518564, 29100074, 31582561, 32510170, 38718836
GO:0032311	Component	Angiogenin-PRI complex	IDA	3470787
GO:0032311	Component	Angiogenin-PRI complex	IPI	3470787
GO:0033554	Process	Cellular response to stress	IDA	38718836
GO:0034063	Process	Stress granule assembly	IDA	20129916, 23047679
GO:0036416	Process	TRNA stabilization	IDA	23843625
GO:0042277	Function	Peptide binding	IDA	11782452
GO:0042327	Process	Positive regulation of phosphorylation	IDA	17125737
GO:0042592	Process	Homeostatic process	NAS	15166501
GO:0042803	Function	Protein homodimerization activity	IDA	25372031
GO:0043022	Function	Ribosome binding	IDA	38718836
GO:0043025	Component	Neuronal cell body	ISS
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	12548285
GO:0048018	Function	Receptor ligand activity	IDA	29100074
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	10103013
GO:0050714	Process	Positive regulation of protein secretion	IDA	2646638
GO:0050714	Process	Positive regulation of protein secretion	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12548285
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12548285
GO:0071425	Process	Hematopoietic stem cell proliferation	IDA	27518564

MIM	HGNC	e!Ensembl
105850	483	ENSG00000214274

P03950

Protein name

Angiogenin (EC 3.1.27.-) (Ribonuclease 5) (RNase 5)

Protein function

Secreted ribonuclease that can either promote or restrict cell proliferation of target cells, depending on the context (PubMed:12051708, PubMed:1400510, PubMed:19332886, PubMed:20129916, PubMed:21855800, PubMed:23047679, PubMed:23843625, PubMed:

PDB

1A4Y , 1ANG , 1AWZ , 1B1E , 1B1I , 1B1J , 1GV7 , 1H0D , 1H52 , 1H53 , 1HBY , 1K58 , 1K59 , 1K5A , 1K5B , 1UN3 , 1UN4 , 1UN5 , 2ANG , 4AHD , 4AHE , 4AHF , 4AHG , 4AHH , 4AHI , 4AHJ , 4AHK , 4AHL , 4AHM , 4AHN , 4AOH , 4B36 , 5EOP , 5EPZ , 5EQO , 5M9A , 5M9C , 5M9G , 5M9J , 5M9M , 5M9P , 5M9Q , 5M9R , 5M9S , 5M9T , 5M9V , 7NPM , 7PNJ , 7PNP , 7PNR , 8AF0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00074	RnaseA	28 → 140	Pancreatic ribonuclease	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in the liver (PubMed:2440105). Also detected in endothelial cells and spinal cord neurons (PubMed:17886298, PubMed:2440105). {ECO:0000269|PubMed:17886298, ECO:0000269|PubMed:2440105}.

Sequence

MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLT
SPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRA
TAGFRNVVVACENGLPVHLDQSIFRRP

Sequence length

147

Interactions

View interactions

	KEGG		Reactome
	Amyotrophic lateral sclerosis		Adherens junctions interactions

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Amyotrophic lateral sclerosis type 9	Pathogenic; Likely pathogenic	rs121909535, rs121909537, rs121909538, rs121909539, rs121909540, rs121909542, rs121909544	RCV000019699 RCV000019701 RCV000019702 RCV000019703 RCV000019704 RCV000019706 RCV000019708

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Amyotrophic lateral sclerosis	Uncertain significance	rs1886957607	RCV001095486
Amyotrophic lateral sclerosis type 10	Conflicting classifications of pathogenicity	rs201068740	RCV002463771
ANG-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	rs535311762, rs141398857, rs2502151829, rs121909536, rs121909541, rs17560, rs149672657, rs201068740	RCV003401757 RCV003422511 RCV003894127 RCV003959800 RCV003934843 RCV003974847 RCV003940211 RCV003413776 RCV003413785
Frontotemporal dementia	Uncertain significance	rs535311762	RCV001848613

Show/Hide Text Mining Associations (69)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Stimulate	33337366
Amyopathic dermatomyositis	Associate	23229115
Amyotrophic Lateral Sclerosis	Associate	17886298, 19363631, 19449021, 20577002, 21085671, 22384259, 22752089, 23100398, 23228179, 23393617, 23665167, 23755159, 23881933, 25372031, 25386690 View all (8 more)
Amyotrophic lateral sclerosis 1	Associate	20577002, 23228179, 25386690
Astrocytoma	Associate	25659096
Autoimmune Diseases	Associate	24860242
Breast Neoplasms	Associate	23977052, 24457100
Carcinogenesis	Associate	11579593, 27317771
Carcinoma Hepatocellular	Associate	14600132, 29614505, 33228611
Carcinoma Non Small Cell Lung	Associate	40007122
Cerebrovascular Disorders	Stimulate	28918499
Colonic Neoplasms	Associate	28561015, 9092516
COVID 19	Associate	36966617
Death	Associate	25124701
Dermatomyositis	Associate	23229115
Diabetes Mellitus Type 1	Stimulate	39273664
Drug Related Side Effects and Adverse Reactions	Associate	26472728
Dry Eye Syndromes	Inhibit	27247515
Endometriosis	Inhibit	18955785
Fatty Liver	Associate	19449021
Gestational Trophoblastic Disease	Associate	35119039
Glioblastoma	Associate	25659096
Glioblastoma	Stimulate	31072237
Glucosephosphate Dehydrogenase Deficiency	Associate	32945351
Heart Failure	Associate	31795484, 35945262
Hemolytic Uremic Syndrome	Associate	33574979
Hypertension	Associate	30530896
Hypoxia	Associate	19363631
Hypoxia	Stimulate	23419171
Immune System Diseases	Associate	24860242
Inflammation	Associate	10961390, 17610002, 24626803, 24860242, 26472728, 33574979
Intracranial Arteriovenous Malformations	Associate	11463715
Laryngeal Diseases	Associate	35513993
Leukemia	Associate	26472728
Liposarcoma	Associate	23155438
Liver Neoplasms	Associate	19449021, 21085671, 25404306
Lymphoma B Cell	Associate	22266868, 32966775
Lymphoma Primary Effusion	Associate	21209106, 22438557
Macrophage Activation Syndrome	Associate	26472728
Macular Degeneration	Associate	21364907
Macular Degeneration	Inhibit	31731799
Macular Degeneration	Stimulate	33115414
Migraine Disorders	Inhibit	28918499
Monoclonal Gammopathy of Undetermined Significance	Associate	24355943
Motor Neuron Disease	Associate	28176817
Multiple Myeloma	Associate	7528139
Muscular Atrophy Spinal	Associate	23155438
Myositis	Associate	23229115
Neoplasm Metastasis	Associate	21364907, 22194915, 22266868
Neoplasms	Associate	10961390, 16937522, 22194915, 22438557, 23419171, 24457100, 24659782, 25659096, 32966775, 9092516
Neoplasms	Inhibit	11579593
Neoplasms	Stimulate	21426933, 22266868
Nervous System Diseases	Associate	25082408
Neurodegenerative Diseases	Associate	22384259, 24659782, 25372031, 34576228
Neuroinflammatory Diseases	Associate	22752089
Neurologic Manifestations	Associate	27915233
Otitis Media	Inhibit	23576001
Ovarian Neoplasms	Associate	33713666
Parkinson Disease	Associate	25386690, 28176817, 32111867, 33875291, 34576228
Parkinson Disease Secondary	Associate	25386690
Prostatic Neoplasms	Associate	38087324
Retinal Drusen	Associate	21364907
Sarcoma Kaposi	Stimulate	22130534, 22438557
Stomach Neoplasms	Associate	10961390, 12684892, 16937522, 33589575
Thyroiditis Autoimmune	Stimulate	39273664
Urinary Bladder Neoplasms	Associate	11579593, 25387487, 27317771, 34898568, 35072652
Vascular Diseases	Associate	23229115, 28918499
Vasospasm Intracranial	Associate	25082408
Vocal Cord Paralysis	Associate	35513993

ANG (angiogenin)