STK32C (serine/threonine kinase 32C)

Gene

• Entrez ID: 282974
• Gene name: Serine/threonine kinase 32C
• Gene symbol: STK32C
• Synonyms (NCBI Gene): PKE, YANK3
• Chromosome: 10
• Chromosome location: 10q26.3
• Summary: The protein encoded by this gene is a member of the serine/threonine protein kinase family. It is thought that this family member is functional in brain due to its high expression levels there. DNA methylation differences have been found in this gene in m

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1397698	hsa-miR-1292	CLIP-seq
MIRT1397699	hsa-miR-1293	CLIP-seq
MIRT1397700	hsa-miR-203	CLIP-seq
MIRT1397701	hsa-miR-302f	CLIP-seq
MIRT1397702	hsa-miR-3194-5p	CLIP-seq
MIRT1397703	hsa-miR-4257	CLIP-seq
MIRT1397704	hsa-miR-4293	CLIP-seq
MIRT1397705	hsa-miR-4330	CLIP-seq
MIRT1397706	hsa-miR-4471	CLIP-seq
MIRT1397707	hsa-miR-4483	CLIP-seq
MIRT1397708	hsa-miR-4505	CLIP-seq
MIRT1397709	hsa-miR-4755-3p	CLIP-seq
MIRT1397710	hsa-miR-544b	CLIP-seq
MIRT1397711	hsa-miR-570	CLIP-seq
MIRT1557150	hsa-miR-1973	CLIP-seq
MIRT1557151	hsa-miR-758	CLIP-seq
MIRT2119079	hsa-miR-3657	CLIP-seq
MIRT1557151	hsa-miR-758	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	22939624, 32296183, 32707033, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 621308
• HGNC: 21332
• e!Ensembl: ENSG00000165752

Protein

• UniProt ID: Q86UX6
• Protein name: Serine/threonine-protein kinase 32C (EC 2.7.11.1) (PKE) (Yet another novel kinase 3)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	93 → 352	Protein kinase domain	Domain

• Sequence:

  MRSGAERRGSSAAASPGSPPPGRARPAGSDAPSALPPPAAGQPRARDSGDVRSQPRPLFQ
  WSKWKKRMGSSMSAATARRPVFDDKEDVNFDHFQILRAIGKGSFGKVCIVQKRDTEKMYA
  MKYMNKQQCIERDEVRNVFRELEILQEIEHVFLVNLWYSFQDEEDMFMVVDLLLGGDLRY
  HLQQNVQFSEDTVRLYICEMALALDYLRGQHIIHRDVKPDNILLDERGHAHLTDFNIATI
  IKDGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVGVMAYELLRGWRPYDIHSS
  NAVESLVQLFSTVSVQYVPTWSKEMVALLRKLLTVNPEHRLSSLQDVQAAPALAGVLWDH
  LSEKRVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNKSRDNSRDSSQSEND
  YLQDCLDAIQQDFVIFNREKLKRSQDLPREPLPAPESRDAAEPVEDEAERSALPMCGPIC
  PSAGSG

• Sequence length: 486

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Alzheimer Disease	Associate	30045751	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Inhibit	20378978	★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Associate	28850114	★☆☆☆☆ Found in Text Mining only
Mental Disorders	Associate	28850114	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	20378978	★☆☆☆☆ Found in Text Mining only