STK32C (serine/threonine kinase 32C)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
282974
Gene name Gene Name - the full gene name approved by the HGNC.
Serine/threonine kinase 32C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STK32C
Synonyms (NCBI Gene) Gene synonyms aliases
PKE, YANK3
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q26.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the serine/threonine protein kinase family. It is thought that this family member is functional in brain due to its high expression levels there. DNA methylation differences have been found in this gene in m
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(18)
miRTarBase ID miRNA Experiments Reference
MIRT1397698 hsa-miR-1292 CLIP-seq
MIRT1397699 hsa-miR-1293 CLIP-seq
MIRT1397700 hsa-miR-203 CLIP-seq
MIRT1397701 hsa-miR-302f CLIP-seq
MIRT1397702 hsa-miR-3194-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0004674 Function Protein serine/threonine kinase activity IBA 21873635
GO:0005515 Function Protein binding IPI 32296183
GO:0005524 Function ATP binding IEA
GO:0018105 Process Peptidyl-serine phosphorylation IBA 21873635
GO:0035556 Process Intracellular signal transduction IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
621308 21332 ENSG00000165752
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q86UX6
Protein name Serine/threonine-protein kinase 32C (EC 2.7.11.1) (PKE) (Yet another novel kinase 3)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 93 → 352 Protein kinase domain Domain
Sequence 
MRSGAERRGSSAAASPGSPPPGRARPAGSDAPSALPPPAAGQPRARDSGDVRSQPRPLFQ
WSKWKKRMGSSMSAATARRPVFDDKEDVNFDHFQILRAIGKGSFGKVCIVQKRDTEKMYA
MKYMNKQQCIERDEVRNVFRELEILQEIEHVFLVNLWYSFQDEEDMFMVVDLLLGGDLRY
HLQQNVQFSEDTVRLYICEMALALDYLRGQHIIHRDVKPDNILLDERGHAHLTDFNIATI
IKDGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVGVMAYELLRGWRPYDIHSS
NAVESLVQLFSTVSVQYVPTWSKEMVALLRKLLTVNPEHRLSSLQDVQAAPALAGVLWDH
LSEKRVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNKSRDNSRDSSQSEND
YLQDCLDAIQQDFVIFNREKLKRSQDLPREPLPAPESRDAAEPVEDEAERSALPMCGPIC
PSAGSG
Sequence length 486
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Show/Hide Text Mining Associations (5)
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 30045751
Colorectal Neoplasms Inhibit 20378978
DiGeorge Syndrome Associate 28850114
Mental Disorders Associate 28850114
Neoplasms Inhibit 20378978