Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	28234
Gene name	Solute carrier organic anion transporter family member 1B3
Gene symbol	SLCO1B3
Synonyms (NCBI Gene)	HBLRRLST-2LST-3TM13LST3OATP-8OATP1B3OATP8SLC21A8
Chromosome	12
Chromosome location	12p12.2
Summary	This gene encodes a liver-specific member of the organic anion transporter family. The encoded protein is a transmembrane receptor that mediates the sodium-independent uptake of endogenous and xenobiotic compounds and plays a critical role in bile acid an

Show/Hide all (91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT614563	hsa-miR-8485	HITS-CLIP	21572407
MIRT614562	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT614561	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT614560	hsa-miR-603	HITS-CLIP	21572407
MIRT614559	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT707567	hsa-miR-142-5p	HITS-CLIP	21572407
MIRT707566	hsa-miR-5590-3p	HITS-CLIP	21572407
MIRT614558	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT614557	hsa-miR-3941	HITS-CLIP	21572407
MIRT707565	hsa-miR-340-5p	HITS-CLIP	21572407
MIRT614556	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT707564	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT614555	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT614563	hsa-miR-8485	HITS-CLIP	23824327
MIRT614562	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614561	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614560	hsa-miR-603	HITS-CLIP	23824327
MIRT614559	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614558	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT614557	hsa-miR-3941	HITS-CLIP	23824327
MIRT614555	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT614563	hsa-miR-8485	HITS-CLIP	23824327
MIRT614562	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614561	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614560	hsa-miR-603	HITS-CLIP	23824327
MIRT614559	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614558	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT614557	hsa-miR-3941	HITS-CLIP	23824327
MIRT614556	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT614555	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT531991	hsa-miR-3936	PAR-CLIP	22012620
MIRT531990	hsa-miR-4457	PAR-CLIP	22012620
MIRT531989	hsa-miR-4639-3p	PAR-CLIP	22012620
MIRT531988	hsa-miR-1470	PAR-CLIP	22012620
MIRT531987	hsa-miR-4667-3p	PAR-CLIP	22012620
MIRT531986	hsa-miR-532-3p	PAR-CLIP	22012620
MIRT531985	hsa-miR-4469	PAR-CLIP	22012620
MIRT531984	hsa-miR-7113-3p	PAR-CLIP	22012620
MIRT531983	hsa-miR-4287	PAR-CLIP	22012620
MIRT531982	hsa-miR-4685-3p	PAR-CLIP	22012620
MIRT531981	hsa-miR-188-3p	PAR-CLIP	22012620
MIRT531980	hsa-miR-6867-3p	PAR-CLIP	22012620
MIRT732660	hsa-miR-579-3p	Luciferase reporter assayqRT-PCR	34031488
MIRT614563	hsa-miR-8485	HITS-CLIP	21572407
MIRT614562	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT614561	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT614560	hsa-miR-603	HITS-CLIP	21572407
MIRT614559	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT707567	hsa-miR-142-5p	HITS-CLIP	21572407
MIRT707566	hsa-miR-5590-3p	HITS-CLIP	21572407
MIRT614558	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT614557	hsa-miR-3941	HITS-CLIP	21572407
MIRT707565	hsa-miR-340-5p	HITS-CLIP	21572407
MIRT614556	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT707564	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT614555	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT614563	hsa-miR-8485	HITS-CLIP	23824327
MIRT614562	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614561	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614560	hsa-miR-603	HITS-CLIP	23824327
MIRT614559	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614558	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT614557	hsa-miR-3941	HITS-CLIP	23824327
MIRT614555	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT614563	hsa-miR-8485	HITS-CLIP	23824327
MIRT614562	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614561	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614560	hsa-miR-603	HITS-CLIP	23824327
MIRT614559	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614558	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT614557	hsa-miR-3941	HITS-CLIP	23824327
MIRT614556	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT614555	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT531991	hsa-miR-3936	PAR-CLIP	22012620
MIRT531990	hsa-miR-4457	PAR-CLIP	22012620
MIRT531989	hsa-miR-4639-3p	PAR-CLIP	22012620
MIRT531988	hsa-miR-1470	PAR-CLIP	22012620
MIRT531987	hsa-miR-4667-3p	PAR-CLIP	22012620
MIRT531986	hsa-miR-532-3p	PAR-CLIP	22012620
MIRT531985	hsa-miR-4469	PAR-CLIP	22012620
MIRT531984	hsa-miR-7113-3p	PAR-CLIP	22012620
MIRT531983	hsa-miR-4287	PAR-CLIP	22012620
MIRT531982	hsa-miR-4685-3p	PAR-CLIP	22012620
MIRT531981	hsa-miR-188-3p	PAR-CLIP	22012620
MIRT531980	hsa-miR-6867-3p	PAR-CLIP	22012620
MIRT1369311	hsa-miR-3910	CLIP-seq
MIRT1369312	hsa-miR-4484	CLIP-seq
MIRT1369313	hsa-miR-520g	CLIP-seq
MIRT1369314	hsa-miR-520h	CLIP-seq
MIRT1369315	hsa-miR-548an	CLIP-seq
MIRT1369316	hsa-miR-579	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
FOXA2	Unknown	16741617
HNF1A	Unknown	16741617
NR1H4	Unknown	16741617

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10779507
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	19129463, 26383540
GO:0008514	Function	Organic anion transmembrane transporter activity	TAS	10779507
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015125	Function	Bile acid transmembrane transporter activity	IBA
GO:0015125	Function	Bile acid transmembrane transporter activity	TAS
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IBA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	TAS
GO:0015711	Process	Organic anion transport	TAS	10779507
GO:0015721	Process	Bile acid and bile salt transport	IBA
GO:0015721	Process	Bile acid and bile salt transport	TAS
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0042167	Process	Heme catabolic process	TAS
GO:0043252	Process	Sodium-independent organic anion transport	IBA
GO:0043252	Process	Sodium-independent organic anion transport	TAS
GO:0055085	Process	Transmembrane transport	IEA

MIM	HGNC	e!Ensembl
605495	10961	ENSG00000111700

Q9NPD5

Protein name

Solute carrier organic anion transporter family member 1B3 (Liver-specific organic anion transporter 2) (LST-2) (OATP1B3) (Organic anion transporter 8) (Organic anion-transporting polypeptide 8) (OATP-8) (Solute carrier family 21 member 8)

Protein function

Mediates the Na(+)-independent uptake of organic anions (PubMed:10779507, PubMed:15159445, PubMed:17412826). Shows broad substrate specificity, can transport both organic anions such as bile acid taurocholate (cholyltaurine) and conjugated stero

PDB

8PG0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03137	OATP	29 → 621	Organic Anion Transporter Polypeptide (OATP) family	Family
PF07648	Kazal_2	460 → 506	Kazal-type serine protease inhibitor domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver, in particular at the basolateral membrane of hepatocytes near the central vein (PubMed:10779507, PubMed:15159445). Expressed in the placenta (PubMed:12409283). In testis, primarily localized to the basal memb

Sequence

MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFD
ISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGY
YRYSKETHINPSENSTSSLSTCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNML
RGIGETPIVPLGISYIDDFAKEGHSSLYLGSLNAIGMIGPVIGFALGSLFAKMYVDIGYV
DLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLPKNPNKPQKERKISLSLHVLK
TNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVSSFIGSFTYVF
KYMEQQYGQSASHANFLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFL
FQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGIT
YLSPCLAGCKSSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNTCTRKFFIYVAI
QVINSLFSATGGTTFILLTVKIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCM
KWSTNSCGAQGACRIYNSVFFGRVYLGLSIALRFPALVLYIVFIFAMKKKFQGKDTKASD
NERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAAN

Sequence length

702

Interactions

View interactions

	KEGG		Reactome
	Bile secretion Folate transport and metabolism		Recycling of bile acids and salts Heme degradation Defective SLCO1B3 causes hyperbilirubinemia, Rotor type (HBLRR) Transport of organic anions

208

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Rotor syndrome	Likely pathogenic; Pathogenic	rs201833947, rs78627909, rs373707046, rs140033394	RCV001802593 RCV001802587 RCV000023445 RCV000779095
SLCO1B3-related disorder	Pathogenic	rs78627909, rs373707046, rs140033394	RCV003968559 RCV003415733 RCV004751699

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cholangiocarcinoma	Benign	rs60140950	RCV005893081
Gastric cancer	Benign	rs4762798	RCV005923274
Gilbert syndrome	Benign	rs2417940, rs2117032	RCV000999566 RCV000999567
Malignant tumor of esophagus	Benign	rs4149134, rs76069495	RCV005918045 RCV005893080
Uterine corpus endometrial carcinoma	Benign	rs4149134	RCV005918046

Show/Hide Text Mining Associations (45)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Stimulate	23307416
Adenocarcinoma	Associate	29658575
Adenocarcinoma of Lung	Associate	34902990
Adrenocortical Carcinoma	Associate	32607875
Bile Duct Diseases	Associate	21615622
Breast Neoplasms	Associate	17760952
Breast Neoplasms	Inhibit	33436824
Carcinoma Hepatocellular	Associate	12695556, 19404564, 21615622, 32534581
Cardiotoxicity	Associate	34230586
Chemical and Drug Induced Liver Injury	Associate	24614281
Cholestasis	Associate	21615622
Colonic Diseases	Associate	29658575
Colonic Neoplasms	Associate	19074900
Colorectal Neoplasms	Associate	19074900, 26894861, 28349822, 34599518
Drug Related Side Effects and Adverse Reactions	Associate	26475344, 28817838, 36988399
Endometrial Neoplasms	Associate	23782748, 33917029
Fatty Liver Alcoholic	Associate	28097795
Fibrosis	Inhibit	23462698
Focal Nodular Hyperplasia	Associate	21628934
Gastrointestinal Neoplasms	Associate	17760952
Gilbert Disease	Associate	24587300
Heart Failure	Associate	30946364
Hyperbilirubinemia	Associate	19419973, 26146841, 38279097
Hyperbilirubinemia Hereditary	Associate	33860121, 36964102
Hyperbilirubinemia Neonatal	Associate	26146841, 38279097
Jaundice Neonatal	Associate	36964102
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	21212528, 23394475, 25056761, 32027818
Leukopenia	Associate	18294295
Liver Cirrhosis	Associate	27543206
Lung Neoplasms	Associate	29577869
Lymphatic Metastasis	Associate	32534581
Melanoma Cutaneous Malignant	Associate	25953768
Musculoskeletal Diseases	Stimulate	23307416
Nasopharyngeal Neoplasms	Associate	21995462
Neoplasms	Associate	12695556, 17760952, 18957548, 21383546, 23782748, 24614281, 25611302, 26894861, 29577869, 32534581, 33707581, 33917029
Neutropenia	Associate	18294295, 28817838
Ovarian Neoplasms	Associate	36988399
Pancreatic Neoplasms	Stimulate	23307416
Pancreatitis	Associate	23307416
Prostatic Neoplasms	Associate	18537956, 21266523, 21606417, 21625523, 30890759, 33707581
Prostatic Neoplasms Castration Resistant	Associate	21266523
Squamous Cell Carcinoma of Head and Neck	Associate	23137910
Testicular Neoplasms	Stimulate	21625523
Thyroid Nodule	Inhibit	21628934
Uterine Cervical Neoplasms	Associate	21278621

SLCO1B3 (solute carrier organic anion transporter family member 1B3)