Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2823
Gene name Gene Name - the full gene name approved by the HGNC.	Glycoprotein M6A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPM6A
Synonyms (NCBI Gene) Gene synonyms aliases	GPM6, M6A
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q34.2

Show/Hide all(85)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020434	hsa-miR-106b-5p	Microarray	17242205
MIRT024239	hsa-miR-218-5p	Sequencing	20371350
MIRT050918	hsa-miR-17-5p	CLASH	23622248
MIRT498419	hsa-miR-548e-5p	PAR-CLIP	22291592
MIRT498418	hsa-miR-548az-5p	PAR-CLIP	22291592
MIRT498417	hsa-miR-548t-5p	PAR-CLIP	22291592
MIRT498419	hsa-miR-548e-5p	PAR-CLIP	22291592
MIRT498418	hsa-miR-548az-5p	PAR-CLIP	22291592
MIRT498417	hsa-miR-548t-5p	PAR-CLIP	22291592
MIRT1029553	hsa-miR-186	CLIP-seq
MIRT1029554	hsa-miR-200b	CLIP-seq
MIRT1029555	hsa-miR-200c	CLIP-seq
MIRT1029556	hsa-miR-3133	CLIP-seq
MIRT1029557	hsa-miR-374c	CLIP-seq
MIRT1029558	hsa-miR-429	CLIP-seq
MIRT1029559	hsa-miR-4650-3p	CLIP-seq
MIRT1029560	hsa-miR-4773	CLIP-seq
MIRT1029561	hsa-miR-628-5p	CLIP-seq
MIRT1029562	hsa-miR-655	CLIP-seq
MIRT1029563	hsa-miR-1206	CLIP-seq
MIRT1029564	hsa-miR-1283	CLIP-seq
MIRT1029565	hsa-miR-2054	CLIP-seq
MIRT1029566	hsa-miR-221	CLIP-seq
MIRT1029567	hsa-miR-222	CLIP-seq
MIRT1029568	hsa-miR-302a	CLIP-seq
MIRT1029569	hsa-miR-302b	CLIP-seq
MIRT1029570	hsa-miR-302c	CLIP-seq
MIRT1029571	hsa-miR-302d	CLIP-seq
MIRT1029572	hsa-miR-302e	CLIP-seq
MIRT1029573	hsa-miR-3074-3p	CLIP-seq
MIRT1029574	hsa-miR-3153	CLIP-seq
MIRT1029575	hsa-miR-330-3p	CLIP-seq
MIRT1029576	hsa-miR-340	CLIP-seq
MIRT1029577	hsa-miR-361-5p	CLIP-seq
MIRT1029578	hsa-miR-3646	CLIP-seq
MIRT1029579	hsa-miR-365	CLIP-seq
MIRT1029580	hsa-miR-372	CLIP-seq
MIRT1029581	hsa-miR-373	CLIP-seq
MIRT1029582	hsa-miR-409-3p	CLIP-seq
MIRT1029583	hsa-miR-4281	CLIP-seq
MIRT1029584	hsa-miR-448	CLIP-seq
MIRT1029585	hsa-miR-4517	CLIP-seq
MIRT1029586	hsa-miR-4668-5p	CLIP-seq
MIRT1029587	hsa-miR-4763-5p	CLIP-seq
MIRT1029588	hsa-miR-519a	CLIP-seq
MIRT1029589	hsa-miR-519b-3p	CLIP-seq
MIRT1029590	hsa-miR-519c-3p	CLIP-seq
MIRT1029591	hsa-miR-520a-3p	CLIP-seq
MIRT1029592	hsa-miR-520b	CLIP-seq
MIRT1029593	hsa-miR-520c-3p	CLIP-seq
MIRT1029594	hsa-miR-520d-3p	CLIP-seq
MIRT1029595	hsa-miR-520d-5p	CLIP-seq
MIRT1029596	hsa-miR-520e	CLIP-seq
MIRT1029597	hsa-miR-524-5p	CLIP-seq
MIRT1029598	hsa-miR-548v	CLIP-seq
MIRT1029599	hsa-miR-653	CLIP-seq
MIRT2005478	hsa-miR-1178	CLIP-seq
MIRT2005479	hsa-miR-452	CLIP-seq
MIRT2005480	hsa-miR-4676-3p	CLIP-seq
MIRT2450554	hsa-miR-3973	CLIP-seq
MIRT2450555	hsa-miR-450b-5p	CLIP-seq
MIRT2450556	hsa-miR-4731-3p	CLIP-seq
MIRT2450557	hsa-miR-4801	CLIP-seq
MIRT2450558	hsa-miR-507	CLIP-seq
MIRT2450559	hsa-miR-548k	CLIP-seq
MIRT2450560	hsa-miR-556-3p	CLIP-seq
MIRT2450561	hsa-miR-557	CLIP-seq
MIRT2542053	hsa-miR-1305	CLIP-seq
MIRT1029573	hsa-miR-3074-3p	CLIP-seq
MIRT2542054	hsa-miR-3671	CLIP-seq
MIRT2542055	hsa-miR-4643	CLIP-seq
MIRT2542056	hsa-miR-466	CLIP-seq
MIRT2542057	hsa-miR-4789-3p	CLIP-seq
MIRT2542058	hsa-miR-485-3p	CLIP-seq
MIRT2542059	hsa-miR-487a	CLIP-seq
MIRT2542060	hsa-miR-607	CLIP-seq
MIRT2542053	hsa-miR-1305	CLIP-seq
MIRT1029573	hsa-miR-3074-3p	CLIP-seq
MIRT2542054	hsa-miR-3671	CLIP-seq
MIRT2542055	hsa-miR-4643	CLIP-seq
MIRT2542056	hsa-miR-466	CLIP-seq
MIRT2542057	hsa-miR-4789-3p	CLIP-seq
MIRT2542058	hsa-miR-485-3p	CLIP-seq
MIRT2542059	hsa-miR-487a	CLIP-seq
MIRT2542060	hsa-miR-607	CLIP-seq

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001764	Process	Neuron migration	IDA	19298174
GO:0003407	Process	Neural retina development	IEA
GO:0003407	Process	Neural retina development	ISS
GO:0005262	Function	Calcium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	17500595, 24705354, 31286866, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0007416	Process	Synapse assembly	IEA
GO:0007416	Process	Synapse assembly	ISS
GO:0009617	Process	Response to bacterium	IEA
GO:0016020	Component	Membrane	IEA
GO:0030175	Component	Filopodium	IBA
GO:0030175	Component	Filopodium	IEA
GO:0030175	Component	Filopodium	ISS
GO:0030424	Component	Axon	IEA
GO:0030426	Component	Growth cone	IEA
GO:0031175	Process	Neuron projection development	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043197	Component	Dendritic spine	IEA
GO:0044295	Component	Axonal growth cone	IBA
GO:0044295	Component	Axonal growth cone	IEA
GO:0044295	Component	Axonal growth cone	ISS
GO:0045202	Component	Synapse	IEA
GO:0048787	Component	Presynaptic active zone membrane	IEA
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0048812	Process	Neuron projection morphogenesis	ISS
GO:0048863	Process	Stem cell differentiation	IDA	19298174
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0051491	Process	Positive regulation of filopodium assembly	IEA
GO:0051491	Process	Positive regulation of filopodium assembly	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0098688	Component	Parallel fiber to Purkinje cell synapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1903561	Component	Extracellular vesicle	HDA	24769233

MIM	HGNC	e!Ensembl
601275	4460	ENSG00000150625

Protein

UniProt ID

P51674

Protein name

Neuronal membrane glycoprotein M6-a (M6a)

Protein function

Involved in neuronal differentiation, including differentiation and migration of neuronal stem cells. Plays a role in neuronal plasticity and is involved in neurite and filopodia outgrowth, filopodia motility and probably synapse formation. GPM6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01275	Myelin_PLP	14 → 247	Myelin proteolipid protein (PLP or lipophilin)	Family

Sequence

MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQT
YFEMARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKIT
TCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNLWTICRNTTLVEGANLCLDLRQF
GIVTIGEEKKICTVSENFLRMCESTELNMTFHLFIVALAGAGAAVIAMVHYLMVLSANWA
YVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT

Sequence length

278

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Neuroticism	Neuroticism	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (79)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abortion Habitual	Associate	31281518
Acute erythroleukemia	Stimulate	10936857
Acute Kidney Injury	Associate	39287046
Adenocarcinoma	Associate	36058934
Adenocarcinoma of Lung	Associate	33428597, 34359836, 34558724, 34650549, 35035657, 35860262, 36061307
Adrenocortical Carcinoma	Associate	33952721
Alzheimer Disease	Associate	32301581, 34705667
Arthritis Rheumatoid	Associate	32884942
Atherosclerosis	Associate	32633395
Bone Diseases Metabolic	Associate	36034449
Breast Neoplasms	Associate	32323801, 36700472, 37705505, 40197314
Breast Neoplasms	Stimulate	33138349
Carcinogenesis	Associate	32091154, 34359836, 34650549, 35090515, 35609514, 35941582, 36168624, 37466203, 37919739
Carcinoma Hepatocellular	Associate	34741346, 35592519, 35833147, 35941582, 35982895, 37170222, 37525171, 38097948
Carcinoma Hepatocellular	Inhibit	35918602
Carcinoma Non Small Cell Lung	Associate	32956555, 34812534, 35186164, 35726651, 37848553, 37919739
Carcinoma Ovarian Epithelial	Associate	36632222
Carcinoma Pancreatic Ductal	Associate	34497315
Carcinoma Renal Cell	Associate	34699322, 35784363, 38270643
Carcinoma Squamous Cell	Associate	35872842, 36058934
Carotid Artery Diseases	Associate	38168909
Colitis Ulcerative	Associate	35795532
Colonic Neoplasms	Associate	37975370
Colorectal Neoplasms	Associate	32605475, 33493136, 38479704, 39810713
Communicable Diseases	Associate	35655464
COVID 19	Associate	35655464
Diabetes Mellitus Type 2	Associate	23392254
Down Syndrome Critical Region	Associate	37449516
Endometrial Neoplasms	Associate	36199963
Epstein Barr Virus Infections	Inhibit	33605073
Fibrosis	Associate	33649237
Glioblastoma	Associate	35852867, 35883571
Glioma	Associate	33264518, 35572524, 36203569
Hypoxia	Associate	27001847, 35799793, 37149664, 38097948
Hypoxia Brain	Associate	34609072, 37149664
Immune System Diseases	Associate	36202899, 37449516
Inflammation	Associate	35035657, 35722625, 35734168
Leukemia Erythroblastic Acute	Associate	10936857
Leukemia Myeloid	Associate	32619516
Leukemia Myeloid Acute	Associate	30991023, 34887874
Leukemia T Cell	Associate	37640841
Liver Cirrhosis	Associate	37534933
Lung Neoplasms	Associate	33428597, 35035657
Lymphatic Metastasis	Inhibit	36632222
Lymphatic Metastasis	Stimulate	38250152
Lymphoma Follicular	Associate	35734168
Lymphoma Non Hodgkin	Associate	35572524
Melanoma	Associate	37466203
Melanoma Cutaneous Malignant	Associate	33490266, 34288419, 35722625
Mouth Neoplasms	Associate	35910847
Nasopharyngeal Carcinoma	Associate	36310139
Neoplasm Metastasis	Associate	34650549, 36974635, 37848553
Neoplasms	Associate	28017614, 32605475, 32747553, 32956555, 33225598, 33264518, 33426808, 33431791, 33493136, 33952721, 34055982, 34531875, 34699322, 34733275, 34887874 View all (27 more)
Neoplasms	Inhibit	35872842
Neurodegenerative Diseases	Associate	34705667
Osteoarthritis	Associate	37006267
Osteoporosis	Associate	36034449, 37449516
Osteosarcoma	Associate	33431791, 35303054, 35978902, 36066162
Ovarian Neoplasms	Associate	33225598, 35991123, 36259156, 36545327, 38098223
Ovarian Neoplasms	Inhibit	36632222
Pancreatic Neoplasms	Associate	34055982, 35404184, 35609514, 35879877, 37149664
Polycystic Ovary Syndrome	Stimulate	32869942
Primary Ovarian Insufficiency	Associate	32869942
Prostatic Neoplasms	Associate	34531875
Rectal Neoplasms	Associate	34613665
Renal Insufficiency Chronic	Associate	39287046
Sarcoma	Associate	38024481
Sepsis	Associate	36505499, 39287046
Squamous Cell Carcinoma of Head and Neck	Associate	35689537, 35910847
Stomach Neoplasms	Associate	35382776, 35502827, 35730319, 35799793, 35936362, 36193316, 37256823, 38082402
Thyroid Cancer Papillary	Associate	35090515
Thyroid Neoplasms	Associate	36974635
Tinnitus	Associate	36581688
Triple Negative Breast Neoplasms	Associate	38104484
Urinary Bladder Neoplasms	Associate	34733275, 34802433, 36168624
Uterine Cervical Dysplasia	Associate	37932662
Uterine Cervical Neoplasms	Associate	35572541, 36058934, 37042849, 38250152
Uterine Diseases	Associate	36199963
Vascular Diseases	Associate	39343042

GPM6A (glycoprotein M6A)