Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2822
Gene name Gene Name - the full gene name approved by the HGNC.	Glycosylphosphatidylinositol specific phospholipase D1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPLD1
Synonyms (NCBI Gene) Gene synonyms aliases	GPIPLD, GPIPLDM, PIGPLD, PIGPLD1, PLD
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p22.3
Summary Summary of gene provided in NCBI Entrez Gene.	Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glyco

Show/Hide all(55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040991	hsa-miR-505-3p	CLASH	23622248
MIRT1029531	hsa-miR-1200	CLIP-seq
MIRT1029532	hsa-miR-302a	CLIP-seq
MIRT1029533	hsa-miR-302b	CLIP-seq
MIRT1029534	hsa-miR-302c	CLIP-seq
MIRT1029535	hsa-miR-302d	CLIP-seq
MIRT1029536	hsa-miR-302e	CLIP-seq
MIRT1029537	hsa-miR-3074-5p	CLIP-seq
MIRT1029538	hsa-miR-3127-5p	CLIP-seq
MIRT1029539	hsa-miR-3657	CLIP-seq
MIRT1029540	hsa-miR-372	CLIP-seq
MIRT1029541	hsa-miR-373	CLIP-seq
MIRT1029542	hsa-miR-4446-5p	CLIP-seq
MIRT1029543	hsa-miR-4669	CLIP-seq
MIRT1029544	hsa-miR-4695-3p	CLIP-seq
MIRT1029545	hsa-miR-4755-5p	CLIP-seq
MIRT1029546	hsa-miR-520a-3p	CLIP-seq
MIRT1029547	hsa-miR-520b	CLIP-seq
MIRT1029548	hsa-miR-520c-3p	CLIP-seq
MIRT1029549	hsa-miR-520d-3p	CLIP-seq
MIRT1029550	hsa-miR-520e	CLIP-seq
MIRT1029551	hsa-miR-642a	CLIP-seq
MIRT1029552	hsa-miR-885-5p	CLIP-seq
MIRT738539	hsa-miR-4267	CLIP-seq
MIRT738538	hsa-miR-4716-5p	CLIP-seq
MIRT738541	hsa-miR-4757-5p	CLIP-seq
MIRT738540	hsa-miR-766	CLIP-seq
MIRT2005470	hsa-miR-3180-5p	CLIP-seq
MIRT2005471	hsa-miR-4455	CLIP-seq
MIRT2005472	hsa-miR-4474-3p	CLIP-seq
MIRT2005473	hsa-miR-4687-3p	CLIP-seq
MIRT2005474	hsa-miR-520a-5p	CLIP-seq
MIRT2005475	hsa-miR-525-5p	CLIP-seq
MIRT2005476	hsa-miR-644	CLIP-seq
MIRT2005477	hsa-miR-425	CLIP-seq
MIRT2238130	hsa-miR-3156-3p	CLIP-seq
MIRT2238131	hsa-miR-4301	CLIP-seq
MIRT2238132	hsa-miR-4729	CLIP-seq
MIRT2238133	hsa-miR-532-3p	CLIP-seq
MIRT738539	hsa-miR-4267	CLIP-seq
MIRT738538	hsa-miR-4716-5p	CLIP-seq
MIRT738540	hsa-miR-766	CLIP-seq
MIRT2450550	hsa-miR-199a-5p	CLIP-seq
MIRT2450551	hsa-miR-199b-5p	CLIP-seq
MIRT2450552	hsa-miR-4302	CLIP-seq
MIRT1029542	hsa-miR-4446-5p	CLIP-seq
MIRT2450553	hsa-miR-4747-3p	CLIP-seq
MIRT1029545	hsa-miR-4755-5p	CLIP-seq
MIRT1029551	hsa-miR-642a	CLIP-seq
MIRT2450550	hsa-miR-199a-5p	CLIP-seq
MIRT2450551	hsa-miR-199b-5p	CLIP-seq
MIRT2450552	hsa-miR-4302	CLIP-seq
MIRT1029542	hsa-miR-4446-5p	CLIP-seq
MIRT2450553	hsa-miR-4747-3p	CLIP-seq
MIRT1029545	hsa-miR-4755-5p	CLIP-seq

Show/Hide all(48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	ISS
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IMP	17720976
GO:0002062	Process	Chondrocyte differentiation	ISS
GO:0002430	Process	Complement receptor mediated signaling pathway	IDA	15907827, 19135435
GO:0004621	Function	Glycosylphosphatidylinositol phospholipase D activity	IBA	21873635
GO:0004621	Function	Glycosylphosphatidylinositol phospholipase D activity	IDA	1833386, 2760042, 15907827, 17720976, 19135435
GO:0004621	Function	Glycosylphosphatidylinositol phospholipase D activity	TAS	2017684
GO:0004630	Function	Phospholipase D activity	IDA	2760042
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	1833386, 2760042, 15907827, 17720976, 17761367
GO:0005737	Component	Cytoplasm	IDA	19135435
GO:0005737	Component	Cytoplasm	ISS
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0006501	Process	C-terminal protein lipidation	TAS
GO:0006507	Process	GPI anchor release	IBA	21873635
GO:0006507	Process	GPI anchor release	IDA	2760042, 15907827, 19135435
GO:0006507	Process	GPI anchor release	IMP	17720976
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	19135435
GO:0008286	Process	Insulin receptor signaling pathway	IDA	18328347
GO:0009749	Process	Response to glucose	IDA	15907827
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	17720976
GO:0010694	Process	Positive regulation of alkaline phosphatase activity	ISS
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	ISS
GO:0010897	Process	Negative regulation of triglyceride catabolic process	ISS
GO:0010907	Process	Positive regulation of glucose metabolic process	ISS
GO:0010983	Process	Positive regulation of high-density lipoprotein particle clearance	ISS
GO:0017080	Function	Sodium channel regulator activity	ISS
GO:0031012	Component	Extracellular matrix	IBA	21873635
GO:0031012	Component	Extracellular matrix	ISS
GO:0032869	Process	Cellular response to insulin stimulus	IDA	15907827
GO:0035690	Process	Cellular response to drug	IDA	17761367
GO:0035701	Process	Hematopoietic stem cell migration	TAS	17368745
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	ISS
GO:0043065	Process	Positive regulation of apoptotic process	IDA	19135435
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	1833386
GO:0046470	Process	Phosphatidylcholine metabolic process	ISS
GO:0046470	Process	Phosphatidylcholine metabolic process	TAS	2017684
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IDA	17720976
GO:0051047	Process	Positive regulation of secretion	ISS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070633	Process	Transepithelial transport	ISS
GO:0071277	Process	Cellular response to calcium ion	IDA	2760042
GO:0071397	Process	Cellular response to cholesterol	IMP	17761367
GO:0071401	Process	Cellular response to triglyceride	IMP	17761367
GO:0071467	Process	Cellular response to pH	IDA	17761367
GO:0097241	Process	Hematopoietic stem cell migration to bone marrow	TAS	17368745
GO:1900076	Process	Regulation of cellular response to insulin stimulus	IDA	18328347

MIM	HGNC	e!Ensembl
602515	4459	ENSG00000112293

Protein

UniProt ID

P80108

Protein name

Phosphatidylinositol-glycan-specific phospholipase D (PI-G PLD) (EC 3.1.4.50) (Glycoprotein phospholipase D) (Glycosyl-phosphatidylinositol-specific phospholipase D) (GPI-PLD) (GPI-specific phospholipase D)

Protein function

This protein hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans (GPI-anchor) thus releasing these proteins from the membrane.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00882	Zn_dep_PLPC	28 → 219	Zinc dependent phospholipase C	Domain
PF01839	FG-GAP	381 → 419	FG-GAP repeat	Repeat
PF01839	FG-GAP	450 → 488	FG-GAP repeat	Repeat
PF01839	FG-GAP	513 → 550	FG-GAP repeat	Repeat

Sequence

MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAY
QAGIVFPDCFYPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLF
GITSHMAADVSWHSLGLEQGFLRTMGAIDFHGSYSEAHSAGDFGGDVLSQFEFNFNYLAR
RWYVPVKDLLGIYEKLYGRKVITENVIVDCSHIQFLEMYGEMLAVSKLYPTYSTKSPFLV
EQFQEYFLGGLDDMAFWSTNIYHLTSFMLENGTSDCNLPENPLFIACGGQQNHTQGSKMQ
KNDFHRNLTTSLTESVDRNINYTERGVFFSVNSWTPDSMSFIYKALERNIRTMFIGGSQL
SQKHVSSPLASYFLSFPYARLGWAMTSADLNQDGHGDLVVGAPGYSRPGHIHIGRVYLIY
GNDLGLPPVDLDLDKEAHRILEGFQPSGRFGSALAVLDFNVDGVPDLAVGAPSVGSEQLT
YKGAVYVYFGSKQGGMSSSPNITISCQDIYCNLGWTLLAADVNGDSEPDLVIGSPFAPGG
GKQKGIVAAFYSGPSLSDKEKLNVEAANWTVRGEEDFSWFGYSLHGVTVDNRTLLLVGSP
TWKNASRLGHLLHIRDEKKSLGRVYGYFPPNGQSWFTISGDKAMGKLGTSLSSGHVLMNG
TLKQVLLVGAPTYDDVSKVAFLTVTLHQGGATRMYALTSDAQPLLLSTFSGDRRFSRFGG
VLHLSDLDDDGLDEIIMAAPLRIADVTSGLIGGEDGRVYVYNGKETTLGDMTGKCKSWIT
PCPEEKAQYVLISPEASSRFGSSLITVRSKAKNQVVIAAGRSSLGARLSGALHVYSLGSD

Sequence length

840

Interactions

View interactions

	KEGG		Reactome
	Glycosylphosphatidylinositol (GPI)-anchor biosynthesis Metabolic pathways		Post-translational modification: synthesis of GPI-anchored proteins

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Succinic semialdehyde dehydrogenase deficiency	succinic semialdehyde dehydrogenase deficiency	rs1561879380, rs1561872640, rs118203982, rs118203983, rs118203984, rs875989801, rs375628463, rs72552281, rs72552284, rs765561257, rs72552282, rs1301821497, rs778127154, rs1561865665, rs1561879345 View all (5 more)

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References
Associations from Text Mining
Adrenoleukodystrophy	Associate	9639664
Aortic Aneurysm Abdominal	Stimulate	22376258
Ataxia Telangiectasia	Associate	6230093
Breast Neoplasms	Associate	16107734, 16595654, 16996503, 17949898, 19478552, 20805015, 23989060, 26787840, 33832505
Carcinogenesis	Associate	19478552, 20625243, 25523098
Carcinoma Basal Cell	Associate	6230093
Carcinoma Non Small Cell Lung	Associate	29062084
Carcinoma Ovarian Epithelial	Associate	20179205
Carotid Artery Diseases	Inhibit	25318463
Drug Related Side Effects and Adverse Reactions	Associate	21461262
Endometrial Neoplasms	Associate	21228924
Glioma	Associate	18067864
Hypoxia	Stimulate	26787840
Infections	Associate	25065577
Inflammation	Associate	11749774, 20625243
Influenza Human	Associate	25065577
Kidney Neoplasms	Associate	20805015
Lewy Body Disease	Inhibit	24632948
Lymphoma Follicular	Associate	16912221
Lymphoma Non Hodgkin	Associate	36362078
Neoplasm Metastasis	Associate	16595654, 36362078
Neoplasms	Associate	16595654, 17949898, 18190795, 20805015, 23989060, 25475140, 25523098, 26781944, 26787840, 29703186, 32615908, 36131027, 36362078
Neoplasms	Inhibit	18067864
Neoplasms Basal Cell	Associate	26567912
Neuroblastoma	Associate	9601059
Neurodegenerative Diseases	Associate	26283796
Ovarian Neoplasms	Inhibit	25025963
Ovarian Neoplasms	Associate	36362078
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11023832
Prostatic Neoplasms	Associate	29136407, 29524555
Stomach Neoplasms	Associate	20625243, 29136407
Thyroid Cancer Papillary	Associate	18498667

GPLD1 (glycosylphosphatidylinositol specific phospholipase D1)