Gene Gene information from NCBI Gene database.
Entrez ID 2801
Gene name Golgin A2
Gene symbol GOLGA2
Synonyms (NCBI Gene)
DEDHMBGM130
Chromosome 9
Chromosome location 9q34.11
Summary The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be
miRNA miRNA information provided by mirtarbase database.
438
miRTarBase ID miRNA Experiments Reference
MIRT040359 hsa-miR-615-3p CLASH 23622248
MIRT716565 hsa-miR-548az-5p HITS-CLIP 19536157
MIRT716564 hsa-miR-548t-5p HITS-CLIP 19536157
MIRT716563 hsa-miR-106a-5p HITS-CLIP 19536157
MIRT716562 hsa-miR-106b-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
49
GO ID Ontology Definition Evidence Reference
GO:0000137 Component Golgi cis cisterna IBA
GO:0000137 Component Golgi cis cisterna IDA 17488291
GO:0000139 Component Golgi membrane TAS
GO:0000922 Component Spindle pole IEA
GO:0000922 Component Spindle pole ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602580 4425 ENSG00000167110
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q08379
Protein name Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95)
Protein function Peripheral membrane component of the cis-Golgi stack that acts as a membrane skeleton that maintains the structure of the Golgi apparatus, and as a vesicle thether that facilitates vesicle fusion to the Golgi membrane (Probable) (PubMed:16489344
PDB 4REY , 6IW8 , 6IWA , 6K06
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15070 GOLGA2L5 381 908 Putative golgin subfamily A member 2-like protein 5 Coiled-coil
PF19046 GM130_C 953 998 GM130 C-terminal binding motif Motif
Sequence
MWPQPRLPPRPAMSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTT
SGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKT
FSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLKDLESRYQQLAVALDSSYVTNKQL
NITIEKLKQQNQEITDQLEEEKKECHQKQGALREQLQVHIQTIGILVSEKAELQTALAHT
QHAARQKEGESEDLASRLQYSRRRVGELERALSAVSTQQKKADRYNKELTKERDALRLEL
YKNTQSNEDLKQEKSELEEKLRVLVTEKAGMQLNLEELQKKLEMTELLLQQFSSRCEAPD
ANQQLQQAMEERAQLEAHLGQVMESVRQLQMERDKYAENLKGESAMWRQRMQQMSEQVHT
LREEKECSMSRVQELETSLAELRNQMAEPPPPEPPAGPSEVEQQLQAEAEHLRKELEGLA
GQLQAQVQDNEGLSRLNREQEERLLELERAAELWGEQAEARRQILETMQNDRTTISRALS
QNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVEL
KSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQGKAV
AEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGEGDGLDREEEEDEEEEEEEAVAVP
QPMPSIPEDLESREAMVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLASAQKEPE
AAAPAPGTGGDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGET
DTIGEYIALYQSQRAVLKERHREKEEYISRLAQDKEEMKVKLLELQELVLRLVGDRNEWH
GRFLAAAQ
NPADEPTSGAPAPQELGAANQQGDLCEVSLAGSVEPAQGEAREGSPRDNPTA
QQIMQLLREMQNPRERPGLGSNPCIPFFYRADENDEVK
ITVI
Sequence length 1002
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Golgi Cisternae Pericentriolar Stack Reorganization
COPII-mediated vesicle transport
COPI-mediated anterograde transport
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
16
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Developmental delay with hypotonia, myopathy, and brain abnormalities Likely pathogenic; Pathogenic rs1830019170, rs2539213235, rs2539204690 RCV003152649
RCV003152422
RCV003152423
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neuromuscular disease Likely pathogenic rs1830019170 RCV002510730
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Familial cancer of breast Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenocarcinoma of Lung Associate 35869490
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorder Associate 33562221
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Inhibit 25208761
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 25892554
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Associate 25208761
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Inhibit 25892554
★☆☆☆☆
Found in Text Mining only
Death Associate 35869490
★☆☆☆☆
Found in Text Mining only
Glioblastoma Associate 31861134
★☆☆☆☆
Found in Text Mining only
Glioma Associate 36552760
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Stimulate 26617790
★☆☆☆☆
Found in Text Mining only