GNL1 (G protein nucleolar 1 (putative))

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2794
Gene name Gene Name - the full gene name approved by the HGNC.
G protein nucleolar 1 (putative)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GNL1
Synonyms (NCBI Gene) Gene synonyms aliases
HSR1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.
The GNL1 gene, identified in the human major histocompatibility complex class I region, shows a high degree of similarity with its mouse counterpart. The GNL1 gene is located less than 2 kb centromeric to HLA-E, in the same transcriptional orientation. GN
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(596)
miRTarBase ID miRNA Experiments Reference
MIRT047182 hsa-miR-182-5p CLASH 23622248
MIRT041886 hsa-miR-484 CLASH 23622248
MIRT610365 hsa-miR-1255b-2-3p HITS-CLIP 23824327
MIRT610364 hsa-miR-890 HITS-CLIP 23824327
MIRT610363 hsa-miR-196a-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0002456 Process T cell mediated immunity NAS 8180467
GO:0003924 Function GTPase activity IBA 21873635
GO:0005198 Function Structural molecule activity NAS 8180467
GO:0005525 Function GTP binding NAS 8180467
GO:0005615 Component Extracellular space NAS 8180467
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
143024 4413 ENSG00000204590
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID P36915
Protein name Guanine nucleotide-binding protein-like 1 (GTP-binding protein HSR1)
Protein function Possible regulatory or functional link with the histocompatibility cluster.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01926 MMR_HSR1 362 → 461 50S ribosome-binding GTPase Family
Sequence 
MPRKKPFSVKQKKKQLQDKRERKRGLQDGLRSSSNSRSGSRERREEQTDTSDGESVTHHI
RRLNQQPSQGLGPRGYDPNRYRLHFERDSREEVERRKRAAREQVLQPVSAELLELDIREV
YQPGSVLDFPRRPPWSYEMSKEQLMSQEERSFQDYLGKIHGAYSSEKLSYFEHNLETWRQ
LWRVLEMSDIVLLITDIRHPVVNFPPALYEYVTGELGLALVLVLNKVDLAPPALVVAWKH
YFHQHYPQLHVVLFTSFPRDPRTPQDPSSVLKKSRRRGRGWTRALGPEQLLRACEAITVG
KVDLSSWREKIARDVAGATWGNGSGEEEEEEDGPAVLVEQQTDSAMEPTGPTQERYKDGV
VTIGCVGFPNVGKSSLINGLVGRKVVSVSRTPGHTRYFQTYFLTPSVKLCDCPGLIFPSL
LPRQLQVLAGIYPIAQIQEPYTAVGYLASRIPVQALLHLRHPEAEDPSAEHPWCAWDICE
AWAEKRGYKTAKAARNDVYRAANSLLRLAVDGRLSLCFHPPGYSEQKGTWESHPETTELV
VLQGRVGPAGDEEEEEEEELSSSCEEEGEEDRDADEEGEGDEETPTSAPGSSLAGRNPYA
LLGEDEC
Sequence length 607
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 17804836, 19503088
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Mental depression Major Depressive Disorder 27479909 ClinVar
Mental Depression Mental Depression GWAS
Dental caries Dental caries GWAS
Show/Hide Text Mining Associations (8)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 33147101
Carcinogenesis Associate 33147101
Colorectal Neoplasms Associate 33147101
Neoplasms Associate 28629911
Neoplasms Stimulate 33147101
Ovarian Neoplasms Associate 28629911
Parkinson Disease Associate 33305682
Stomach Neoplasms Associate 30061673