Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2785
Gene name	G protein subunit gamma 3
Gene symbol	GNG3
Synonyms (NCBI Gene)	HG3D
Chromosome	11
Chromosome location	11q12.3
Summary	Guanine nucleotide binding proteins are heterotrimeric signal-transducing molecules consisting of alpha, beta, and gamma subunits. The gamma subunit determines the specificity of which signaling pathways will be affected by this particular complex. The pr

Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT460106	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT460107	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT460105	hsa-miR-1321	PAR-CLIP	23592263
MIRT460104	hsa-miR-4739	PAR-CLIP	23592263
MIRT460103	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT460102	hsa-miR-7160-3p	PAR-CLIP	23592263
MIRT460101	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT460100	hsa-miR-665	PAR-CLIP	23592263
MIRT460099	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT460098	hsa-miR-6124	PAR-CLIP	23592263
MIRT460097	hsa-miR-765	PAR-CLIP	23592263
MIRT460096	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT460095	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT460106	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT460107	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT460105	hsa-miR-1321	PAR-CLIP	23592263
MIRT460104	hsa-miR-4739	PAR-CLIP	23592263
MIRT460103	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT460102	hsa-miR-7160-3p	PAR-CLIP	23592263
MIRT460101	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT460100	hsa-miR-665	PAR-CLIP	23592263
MIRT460099	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT460098	hsa-miR-6124	PAR-CLIP	23592263
MIRT460097	hsa-miR-765	PAR-CLIP	23592263
MIRT460096	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT460095	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT2003856	hsa-miR-3150a-5p	CLIP-seq
MIRT2003857	hsa-miR-3150b-5p	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	TAS	10075696
GO:0005515	Function	Protein binding	IPI	26900580, 32296183
GO:0005834	Component	Heterotrimeric G-protein complex	IBA
GO:0005834	Component	Heterotrimeric G-protein complex	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031681	Function	G-protein beta-subunit binding	IBA
GO:0031681	Function	G-protein beta-subunit binding	IEA
GO:0044297	Component	Cell body	IEA
GO:0045202	Component	Synapse	IEA

MIM	HGNC	e!Ensembl
608941	4405	ENSG00000162188

P63215

Protein name

Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3

Protein function

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G prote

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00631	G-gamma	9 → 75	GGL domain	Domain

Sequence

MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT
SENPFREKKFFCALL

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway Chemokine signaling pathway Hormone signaling PI3K-Akt signaling pathway Apelin signaling pathway Circadian entrainment Retrograde endocannabinoid signaling Glutamatergic synapse Cholinergic synapse Serotonergic synapse GABAergic synapse Dopaminergic synapse Relaxin signaling pathway Morphine addiction Alcoholism Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Human immunodeficiency virus 1 infection Pathways in cancer		Activation of G protein gated Potassium channels Glucagon signaling in metabolic regulation G-protein activation Glucagon-like Peptide-1 (GLP1) regulates insulin secretion ADP signalling through P2Y purinoceptor 12 G beta:gamma signalling through PI3Kgamma Prostacyclin signalling through prostacyclin receptor Adrenaline,noradrenaline inhibits insulin secretion Ca2+ pathway G alpha (q) signalling events G alpha (12/13) signalling events G beta:gamma signalling through PLC beta G alpha (s) signalling events ADP signalling through P2Y purinoceptor 1 G alpha (i) signalling events G alpha (z) signalling events Glucagon-type ligand receptors Thromboxane signalling through TP receptor Vasopressin regulates renal water homeostasis via Aquaporins Thrombin signalling through proteinase activated receptors (PARs) Presynaptic function of Kainate receptors Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding G beta:gamma signalling through BTK G beta:gamma signalling through CDC42 Extra-nuclear estrogen signaling ADORA2B mediated anti-inflammatory cytokines production Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CONGENITAL GENERALIZED LIPODYSTROPHY TYPE 2	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURONOPATHY, DISTAL HEREDITARY MOTOR, AUTOSOMAL DOMINANT 13	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA 17	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Diabetes Mellitus Type 2	Associate	33149760	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Associate	37192718	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	32467990	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	37192718	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keloid	Associate	34600545	★★★★★ ★☆☆☆☆ Found in Text Mining only

GNG3 (G protein subunit gamma 3)