GML (glycosylphosphatidylinositol anchored molecule like)

Gene Gene information from NCBI Gene database.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID 2765
Gene name Glycosylphosphatidylinositol anchored molecule like
Gene symbol GML
Synonyms (NCBI Gene)
LY6DL
Chromosome 8
Chromosome location 8q24.3
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (1)
Transcription factor Regulation Reference
TP53 Activation 10717525
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS 8934543
GO:0006915 Process Apoptotic process TAS 8934543
GO:0008285 Process Negative regulation of cell population proliferation TAS 8934543
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
602370 4375 ENSG00000104499
Protein Protein information from UniProt database.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99445
Protein name Glycosyl-phosphatidylinositol-anchored molecule-like protein
Protein function May play a role in the apoptotic pathway or cell-cycle regulation induced by p53/TP53 after DNA damage.
Family and domains
Sequence 
MLLFALLLAMELPLVAASATMRAQWTYSLRCHDCAVINDFNCPNIRVCPYHIRRCMTISI
RINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLER
DMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP
Sequence length 158
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Autism Likely benign rs370445874 RCV003328498
Show/Hide Text Mining Associations (1)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Hypertension Associate 32854392