GML (glycosylphosphatidylinositol anchored molecule like)

Gene
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2765
Gene name Gene Name - the full gene name approved by the HGNC.
Glycosylphosphatidylinositol anchored molecule like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GML
Synonyms (NCBI Gene) Gene synonyms aliases
LY6DL
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.3
Transcription factors
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
TP53 Activation 10717525
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IEA
GO:0006915 Process Apoptotic process TAS 8934543
GO:0006977 Process DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest TAS 8934543
GO:0008285 Process Negative regulation of cell population proliferation TAS 8934543
GO:0019898 Component Extrinsic component of membrane TAS 8934543
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
602370 4375 ENSG00000104499
Protein
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Q99445
Protein name Glycosyl-phosphatidylinositol-anchored molecule-like protein
Protein function May play a role in the apoptotic pathway or cell-cycle regulation induced by p53/TP53 after DNA damage.
Family and domains
Sequence 
MLLFALLLAMELPLVAASATMRAQWTYSLRCHDCAVINDFNCPNIRVCPYHIRRCMTISI
RINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLER
DMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP
Sequence length 158
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (4)
Causal
Disease term Disease name dbSNP ID References
Congenital adrenal hyperplasia Congenital adrenal hyperplasia, Congenital adrenal hyperplasia due to 11-Beta-hydroxylase deficiency rs104894069, rs1365173817, rs104894070, rs556794126, rs104894138, rs104894139, rs104894149, rs104894142, rs104894153, rs6471, rs7769409, rs9378251, rs201552310, rs397509367, rs6445
View all (55 more)		 8768848, 24987415, 18663314, 25911436, 26956189, 8506298, 10487675, 24536089, 24022297, 23940125, 26476331, 26265915, 26066897, 28228528, 22964742
View all (15 more)
Corticosterone methyl oxidase deficiency Corticosterone Methyl Oxidase Type I Deficiency, Corticosterone Methyl Oxidase Type II Deficiency rs121912977, rs121912978, rs72554626, rs121912979, rs771908700, rs771164401, rs539836429
Hyperaldosteronism Glucocorticoid-remediable aldosteronism rs28934586, rs104894068, rs387906778, rs386352319, rs587777437, rs587777438, rs587777439, rs786205050, rs771507094, rs1085307938, rs1553853557, rs1553856214, rs1293789661, rs1553857113, rs758379595
Hypertension Hypertensive disease rs13306026 30487518
Show/Hide Text Mining Associations (1)
Associations from Text Mining
Disease Name Relationship Type References
Hypertension Associate 32854392