Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2737
Gene name Gene Name - the full gene name approved by the HGNC.	GLI family zinc finger 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GLI3
Synonyms (NCBI Gene) Gene synonyms aliases	ACLS, GCPS, GLI3-190, GLI3FL, PAP-A, PAPA, PAPA1, PAPB, PHS, PPDIV
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7p14.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene l

Show/Hide all(86)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28933372	C>G	Pathogenic	Missense variant, coding sequence variant
rs34245321	C>A,G,T	Conflicting-interpretations-of-pathogenicity, benign, likely-benign	Synonymous variant, coding sequence variant
rs79625212	C>A,T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs116840742	TCGG>-	Pathogenic	Coding sequence variant, frameshift variant
rs116840743	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs116840744	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs116840745	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs116840746	CC>AT	Pathogenic	Coding sequence variant, stop gained
rs116840747	C>A	Pathogenic	Coding sequence variant, stop gained
rs116840748	G>A	Pathogenic	Coding sequence variant, stop gained
rs116840749	G>-	Pathogenic	Coding sequence variant, stop gained
rs116840750	G>A	Pathogenic	Coding sequence variant, stop gained
rs116840751	G>A	Pathogenic	Coding sequence variant, stop gained
rs116840752	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs116840753	->G	Pathogenic	Coding sequence variant, frameshift variant
rs116840754	CATCGGTCAGAGGAAGCTC>-	Pathogenic	Coding sequence variant, frameshift variant
rs116840755	GT>-	Pathogenic	Coding sequence variant, frameshift variant
rs116840756	GTTTTAGCCTT>-	Pathogenic	Coding sequence variant, frameshift variant
rs116840757	GTTTT>-	Pathogenic	Coding sequence variant, frameshift variant
rs116840758	C>T	Pathogenic	Splice donor variant
rs116840759	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs116840760	G>A,T	Pathogenic	Missense variant, coding sequence variant, stop gained
rs116840761	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs116840762	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs116840763	G>C	Pathogenic	Coding sequence variant, stop gained
rs116840764	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs116840765	C>-	Pathogenic	Coding sequence variant, stop gained
rs116840766	G>A,C,T	Pathogenic	Synonymous variant, coding sequence variant, stop gained
rs116840767	AA>-,A	Pathogenic	Frameshift variant, coding sequence variant, stop gained
rs116840768	C>A,G	Pathogenic	Missense variant, coding sequence variant, stop gained
rs116840769	C>A,G	Pathogenic	Missense variant, coding sequence variant
rs116840770	G>A	Pathogenic	Coding sequence variant, stop gained
rs121917709	G>A	Pathogenic	Coding sequence variant, stop gained
rs121917710	C>T	Benign-likely-benign, benign, likely-pathogenic, uncertain-significance, likely-benign	Missense variant, coding sequence variant
rs121917711	C>A	Pathogenic	Coding sequence variant, stop gained
rs121917712	G>A	Pathogenic	Missense variant, coding sequence variant
rs121917713	G>A	Pathogenic	Coding sequence variant, stop gained
rs121917714	G>A	Pathogenic	Coding sequence variant, stop gained
rs121917715	G>A	Pathogenic	Coding sequence variant, stop gained
rs121917716	G>A	Likely-benign, uncertain-significance, pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs146582871	G>C	Likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs148226583	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs149248727	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant
rs199875457	A>C,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant
rs398122899	CT>-	Pathogenic	Frameshift variant, coding sequence variant
rs748606221	T>C	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant
rs758771584	T>C	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs760303531	A>G,T	Pathogenic	Synonymous variant, coding sequence variant, stop gained
rs772948115	G>A,C	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs779898173	G>A,C	Pathogenic	Coding sequence variant, stop gained, synonymous variant
rs780263938	G>C	Risk-factor	Coding sequence variant, missense variant
rs886039667	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs886043938	G>A	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs1057518698	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1057520063	->A	Pathogenic	Stop gained, coding sequence variant
rs1060499558	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1064793685	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1064796278	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1375768446	C>T	Likely-pathogenic	Splice donor variant
rs1554304247	->G	Pathogenic	Coding sequence variant, frameshift variant
rs1554304380	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1554304508	A>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1554306031	G>A	Pathogenic	Coding sequence variant, stop gained
rs1554306093	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1554306094	C>T	Pathogenic	Coding sequence variant, missense variant
rs1554314581	->TGCTCTTGGGTGTCGAACTCCCTCGC	Pathogenic	Coding sequence variant, frameshift variant
rs1554314595	C>T	Pathogenic	Coding sequence variant, stop gained
rs1554315071	GTTCAGAACCGTAGGG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1554317931	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1562656759	C>A	Pathogenic	Coding sequence variant, stop gained
rs1562656975	G>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1562657370	->TAATCTGCCC	Likely-pathogenic	Coding sequence variant, stop gained, inframe indel
rs1562657560	TGACTCATT>A	Pathogenic	Coding sequence variant, frameshift variant
rs1562667078	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1562690271	C>T	Pathogenic	Coding sequence variant, stop gained
rs1583500982	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1583505882	A>C	Pathogenic	Coding sequence variant, stop gained
rs1583728165	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1583728402	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1583728570	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1583729398	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1583729562	->G	Pathogenic	Coding sequence variant, frameshift variant
rs1583734240	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1583747773	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1583801167	TA>-	Pathogenic	Coding sequence variant, stop gained
rs1583805203	G>A	Pathogenic	Coding sequence variant, stop gained

Show/Hide all(477)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048909	hsa-miR-93-5p	CLASH	23622248
MIRT043590	hsa-miR-148b-3p	CLASH	23622248
MIRT043590	hsa-miR-148b-3p	CLASH	23622248
MIRT035969	hsa-miR-1301-3p	CLASH	23622248
MIRT438838	hsa-miR-200c-3p	qRT-PCR	23294929
MIRT438838	hsa-miR-200c-3p	qRT-PCR	23294929
MIRT731322	hsa-miR-378a-3p	Luciferase reporter assay	27001906
MIRT731322	hsa-miR-378a-3p	Luciferase reporter assay	27001906
MIRT731322	hsa-miR-378a-3p	Luciferase reporter assay	27001906
MIRT731322	hsa-miR-378a-3p	Luciferase reporter assay	27001906
MIRT1020901	hsa-miR-1184	CLIP-seq
MIRT1020902	hsa-miR-1205	CLIP-seq
MIRT1020903	hsa-miR-1206	CLIP-seq
MIRT1020904	hsa-miR-1286	CLIP-seq
MIRT1020905	hsa-miR-1287	CLIP-seq
MIRT1020906	hsa-miR-1323	CLIP-seq
MIRT1020907	hsa-miR-1908	CLIP-seq
MIRT1020908	hsa-miR-194	CLIP-seq
MIRT1020909	hsa-miR-200b	CLIP-seq
MIRT1020910	hsa-miR-200c	CLIP-seq
MIRT1020911	hsa-miR-299-5p	CLIP-seq
MIRT1020912	hsa-miR-3135b	CLIP-seq
MIRT1020913	hsa-miR-3158-5p	CLIP-seq
MIRT1020914	hsa-miR-3180	CLIP-seq
MIRT1020915	hsa-miR-3180-3p	CLIP-seq
MIRT1020916	hsa-miR-3196	CLIP-seq
MIRT1020917	hsa-miR-346	CLIP-seq
MIRT1020918	hsa-miR-3659	CLIP-seq
MIRT1020919	hsa-miR-3920	CLIP-seq
MIRT1020920	hsa-miR-3942-5p	CLIP-seq
MIRT1020921	hsa-miR-4277	CLIP-seq
MIRT1020922	hsa-miR-4288	CLIP-seq
MIRT1020923	hsa-miR-429	CLIP-seq
MIRT1020924	hsa-miR-4328	CLIP-seq
MIRT1020925	hsa-miR-433	CLIP-seq
MIRT1020926	hsa-miR-4422	CLIP-seq
MIRT1020927	hsa-miR-4457	CLIP-seq
MIRT1020928	hsa-miR-4488	CLIP-seq
MIRT1020929	hsa-miR-4504	CLIP-seq
MIRT1020930	hsa-miR-4508	CLIP-seq
MIRT1020931	hsa-miR-4633-5p	CLIP-seq
MIRT1020932	hsa-miR-4643	CLIP-seq
MIRT1020933	hsa-miR-4658	CLIP-seq
MIRT1020934	hsa-miR-4666-5p	CLIP-seq
MIRT1020935	hsa-miR-4677-3p	CLIP-seq
MIRT1020936	hsa-miR-4679	CLIP-seq
MIRT1020937	hsa-miR-4697-5p	CLIP-seq
MIRT1020938	hsa-miR-4703-5p	CLIP-seq
MIRT1020939	hsa-miR-4719	CLIP-seq
MIRT1020940	hsa-miR-4722-5p	CLIP-seq
MIRT1020941	hsa-miR-4728-3p	CLIP-seq
MIRT1020942	hsa-miR-4731-3p	CLIP-seq
MIRT1020943	hsa-miR-4758-5p	CLIP-seq
MIRT1020944	hsa-miR-4762-3p	CLIP-seq
MIRT1020945	hsa-miR-4775	CLIP-seq
MIRT1020946	hsa-miR-4778-5p	CLIP-seq
MIRT1020947	hsa-miR-4801	CLIP-seq
MIRT1020948	hsa-miR-532-5p	CLIP-seq
MIRT1020949	hsa-miR-542-3p	CLIP-seq
MIRT1020950	hsa-miR-548a-3p	CLIP-seq
MIRT1020951	hsa-miR-548e	CLIP-seq
MIRT1020952	hsa-miR-548f	CLIP-seq
MIRT1020953	hsa-miR-548o	CLIP-seq
MIRT1020954	hsa-miR-549	CLIP-seq
MIRT1020955	hsa-miR-574-5p	CLIP-seq
MIRT1020956	hsa-miR-578	CLIP-seq
MIRT1020957	hsa-miR-581	CLIP-seq
MIRT1020958	hsa-miR-582-5p	CLIP-seq
MIRT1020959	hsa-miR-583	CLIP-seq
MIRT1020960	hsa-miR-590-3p	CLIP-seq
MIRT1020961	hsa-miR-600	CLIP-seq
MIRT1020962	hsa-miR-632	CLIP-seq
MIRT1020963	hsa-miR-654-3p	CLIP-seq
MIRT1020964	hsa-miR-663	CLIP-seq
MIRT1020965	hsa-miR-744	CLIP-seq
MIRT1020903	hsa-miR-1206	CLIP-seq
MIRT1020925	hsa-miR-433	CLIP-seq
MIRT1020903	hsa-miR-1206	CLIP-seq
MIRT2002489	hsa-miR-141	CLIP-seq
MIRT2002490	hsa-miR-200a	CLIP-seq
MIRT2002491	hsa-miR-296-3p	CLIP-seq
MIRT2002492	hsa-miR-3117-5p	CLIP-seq
MIRT2002493	hsa-miR-3174	CLIP-seq
MIRT2002494	hsa-miR-3183	CLIP-seq
MIRT2002495	hsa-miR-3197	CLIP-seq
MIRT2002496	hsa-miR-3612	CLIP-seq
MIRT2002497	hsa-miR-3662	CLIP-seq
MIRT2002498	hsa-miR-3909	CLIP-seq
MIRT2002499	hsa-miR-3925-5p	CLIP-seq
MIRT2002500	hsa-miR-3942-3p	CLIP-seq
MIRT2002501	hsa-miR-4316	CLIP-seq
MIRT2002502	hsa-miR-432	CLIP-seq
MIRT1020925	hsa-miR-433	CLIP-seq
MIRT2002503	hsa-miR-4443	CLIP-seq
MIRT1020927	hsa-miR-4457	CLIP-seq
MIRT2002504	hsa-miR-4505	CLIP-seq
MIRT1020931	hsa-miR-4633-5p	CLIP-seq
MIRT2002505	hsa-miR-4694-3p	CLIP-seq
MIRT2002506	hsa-miR-4704-5p	CLIP-seq
MIRT2002507	hsa-miR-4723-3p	CLIP-seq
MIRT2002508	hsa-miR-4731-5p	CLIP-seq
MIRT2002509	hsa-miR-485-5p	CLIP-seq
MIRT2002510	hsa-miR-513c	CLIP-seq
MIRT2002511	hsa-miR-514b-5p	CLIP-seq
MIRT1020948	hsa-miR-532-5p	CLIP-seq
MIRT2002512	hsa-miR-587	CLIP-seq
MIRT1020961	hsa-miR-600	CLIP-seq
MIRT2002513	hsa-miR-627	CLIP-seq
MIRT2002514	hsa-miR-637	CLIP-seq
MIRT2002515	hsa-miR-650	CLIP-seq
MIRT2002516	hsa-miR-720	CLIP-seq
MIRT2002517	hsa-miR-759	CLIP-seq
MIRT2002518	hsa-miR-921	CLIP-seq
MIRT2002519	hsa-miR-924	CLIP-seq
MIRT1020901	hsa-miR-1184	CLIP-seq
MIRT1020902	hsa-miR-1205	CLIP-seq
MIRT1020903	hsa-miR-1206	CLIP-seq
MIRT2235435	hsa-miR-1236	CLIP-seq
MIRT2235436	hsa-miR-124	CLIP-seq
MIRT2235437	hsa-miR-1257	CLIP-seq
MIRT1020904	hsa-miR-1286	CLIP-seq
MIRT2235438	hsa-miR-1302	CLIP-seq
MIRT2235439	hsa-miR-1303	CLIP-seq
MIRT1020906	hsa-miR-1323	CLIP-seq
MIRT2235440	hsa-miR-138	CLIP-seq
MIRT2235441	hsa-miR-149	CLIP-seq
MIRT2235442	hsa-miR-153	CLIP-seq
MIRT2235443	hsa-miR-154	CLIP-seq
MIRT2235444	hsa-miR-185	CLIP-seq
MIRT1020908	hsa-miR-194	CLIP-seq
MIRT1020909	hsa-miR-200b	CLIP-seq
MIRT1020910	hsa-miR-200c	CLIP-seq
MIRT2235445	hsa-miR-203	CLIP-seq
MIRT2235446	hsa-miR-2053	CLIP-seq
MIRT2235447	hsa-miR-214	CLIP-seq
MIRT2235448	hsa-miR-216a	CLIP-seq
MIRT2235449	hsa-miR-216b	CLIP-seq
MIRT2235450	hsa-miR-217	CLIP-seq
MIRT2235451	hsa-miR-223	CLIP-seq
MIRT2235452	hsa-miR-2909	CLIP-seq
MIRT2002491	hsa-miR-296-3p	CLIP-seq
MIRT2235453	hsa-miR-3064-5p	CLIP-seq
MIRT2002492	hsa-miR-3117-5p	CLIP-seq
MIRT2235454	hsa-miR-3120-3p	CLIP-seq
MIRT2235455	hsa-miR-3121-5p	CLIP-seq
MIRT2235456	hsa-miR-3123	CLIP-seq
MIRT2235457	hsa-miR-3143	CLIP-seq
MIRT2235458	hsa-miR-3151	CLIP-seq
MIRT1020913	hsa-miR-3158-5p	CLIP-seq
MIRT2235459	hsa-miR-3163	CLIP-seq
MIRT2235460	hsa-miR-3170	CLIP-seq
MIRT2002493	hsa-miR-3174	CLIP-seq
MIRT2002494	hsa-miR-3183	CLIP-seq
MIRT2235461	hsa-miR-3188	CLIP-seq
MIRT2002495	hsa-miR-3197	CLIP-seq
MIRT2235462	hsa-miR-326	CLIP-seq
MIRT2235463	hsa-miR-330-5p	CLIP-seq
MIRT1020917	hsa-miR-346	CLIP-seq
MIRT2002496	hsa-miR-3612	CLIP-seq
MIRT2235464	hsa-miR-3619-5p	CLIP-seq
MIRT2235465	hsa-miR-3652	CLIP-seq
MIRT1020918	hsa-miR-3659	CLIP-seq
MIRT2002497	hsa-miR-3662	CLIP-seq
MIRT2235466	hsa-miR-3714	CLIP-seq
MIRT2002498	hsa-miR-3909	CLIP-seq
MIRT2235467	hsa-miR-3910	CLIP-seq
MIRT2002499	hsa-miR-3925-5p	CLIP-seq
MIRT2002500	hsa-miR-3942-3p	CLIP-seq
MIRT2235468	hsa-miR-4264	CLIP-seq
MIRT2235469	hsa-miR-4265	CLIP-seq
MIRT2235470	hsa-miR-4266	CLIP-seq
MIRT1020921	hsa-miR-4277	CLIP-seq
MIRT2235471	hsa-miR-4281	CLIP-seq
MIRT2235472	hsa-miR-4287	CLIP-seq
MIRT1020922	hsa-miR-4288	CLIP-seq
MIRT1020923	hsa-miR-429	CLIP-seq
MIRT2235473	hsa-miR-4293	CLIP-seq
MIRT2235474	hsa-miR-4296	CLIP-seq
MIRT2235475	hsa-miR-4298	CLIP-seq
MIRT2235476	hsa-miR-4306	CLIP-seq
MIRT2235477	hsa-miR-4310	CLIP-seq
MIRT2235478	hsa-miR-4312	CLIP-seq
MIRT2002501	hsa-miR-4316	CLIP-seq
MIRT2002502	hsa-miR-432	CLIP-seq
MIRT2235479	hsa-miR-4322	CLIP-seq
MIRT1020924	hsa-miR-4328	CLIP-seq
MIRT1020925	hsa-miR-433	CLIP-seq
MIRT2235480	hsa-miR-4430	CLIP-seq
MIRT2235481	hsa-miR-4434	CLIP-seq
MIRT2002503	hsa-miR-4443	CLIP-seq
MIRT2235482	hsa-miR-4447	CLIP-seq
MIRT2235483	hsa-miR-4448	CLIP-seq
MIRT1020927	hsa-miR-4457	CLIP-seq
MIRT2235484	hsa-miR-4469	CLIP-seq
MIRT2235485	hsa-miR-4472	CLIP-seq
MIRT2235486	hsa-miR-4474-3p	CLIP-seq
MIRT2235487	hsa-miR-4477b	CLIP-seq
MIRT2002504	hsa-miR-4505	CLIP-seq
MIRT2235488	hsa-miR-4516	CLIP-seq
MIRT2235489	hsa-miR-4531	CLIP-seq
MIRT2235490	hsa-miR-455-3p	CLIP-seq
MIRT1020931	hsa-miR-4633-5p	CLIP-seq
MIRT2235491	hsa-miR-4637	CLIP-seq
MIRT1020932	hsa-miR-4643	CLIP-seq
MIRT2235492	hsa-miR-4644	CLIP-seq
MIRT1020933	hsa-miR-4658	CLIP-seq
MIRT1020934	hsa-miR-4666-5p	CLIP-seq
MIRT2235493	hsa-miR-4685-3p	CLIP-seq
MIRT2002505	hsa-miR-4694-3p	CLIP-seq
MIRT2235494	hsa-miR-4694-5p	CLIP-seq
MIRT2235495	hsa-miR-4695-5p	CLIP-seq
MIRT2002506	hsa-miR-4704-5p	CLIP-seq
MIRT2235496	hsa-miR-4713-5p	CLIP-seq
MIRT1020940	hsa-miR-4722-5p	CLIP-seq
MIRT2002507	hsa-miR-4723-3p	CLIP-seq
MIRT1020942	hsa-miR-4731-3p	CLIP-seq
MIRT2235497	hsa-miR-4759	CLIP-seq
MIRT2235498	hsa-miR-4773	CLIP-seq
MIRT2235499	hsa-miR-4779	CLIP-seq
MIRT2235500	hsa-miR-4790-3p	CLIP-seq
MIRT2235501	hsa-miR-4794	CLIP-seq
MIRT2235502	hsa-miR-4797-3p	CLIP-seq
MIRT1020947	hsa-miR-4801	CLIP-seq
MIRT2235503	hsa-miR-4803	CLIP-seq
MIRT2002509	hsa-miR-485-5p	CLIP-seq
MIRT2235504	hsa-miR-491-5p	CLIP-seq
MIRT2235505	hsa-miR-506	CLIP-seq
MIRT2235506	hsa-miR-509-3p	CLIP-seq
MIRT1020948	hsa-miR-532-5p	CLIP-seq
MIRT2235507	hsa-miR-539	CLIP-seq
MIRT2235508	hsa-miR-543	CLIP-seq
MIRT2235509	hsa-miR-544b	CLIP-seq
MIRT2235510	hsa-miR-545	CLIP-seq
MIRT1020950	hsa-miR-548a-3p	CLIP-seq
MIRT1020951	hsa-miR-548e	CLIP-seq
MIRT1020952	hsa-miR-548f	CLIP-seq
MIRT1020953	hsa-miR-548o	CLIP-seq
MIRT2235511	hsa-miR-548p	CLIP-seq
MIRT2235512	hsa-miR-548q	CLIP-seq
MIRT2235513	hsa-miR-548t	CLIP-seq
MIRT2235514	hsa-miR-569	CLIP-seq
MIRT1020955	hsa-miR-574-5p	CLIP-seq
MIRT2235515	hsa-miR-582-3p	CLIP-seq
MIRT2002512	hsa-miR-587	CLIP-seq
MIRT2235516	hsa-miR-596	CLIP-seq
MIRT1020962	hsa-miR-632	CLIP-seq
MIRT2235517	hsa-miR-642a	CLIP-seq
MIRT2002515	hsa-miR-650	CLIP-seq
MIRT1020963	hsa-miR-654-3p	CLIP-seq
MIRT2235518	hsa-miR-7	CLIP-seq
MIRT2002516	hsa-miR-720	CLIP-seq
MIRT2002517	hsa-miR-759	CLIP-seq
MIRT2235519	hsa-miR-761	CLIP-seq
MIRT2235520	hsa-miR-765	CLIP-seq
MIRT2235521	hsa-miR-889	CLIP-seq
MIRT2002518	hsa-miR-921	CLIP-seq
MIRT2235522	hsa-miR-935	CLIP-seq
MIRT1020906	hsa-miR-1323	CLIP-seq
MIRT2388491	hsa-miR-1587	CLIP-seq
MIRT2388492	hsa-miR-378g	CLIP-seq
MIRT2235471	hsa-miR-4281	CLIP-seq
MIRT2388493	hsa-miR-4492	CLIP-seq
MIRT2388494	hsa-miR-4498	CLIP-seq
MIRT2388495	hsa-miR-4656	CLIP-seq
MIRT2388496	hsa-miR-4675	CLIP-seq
MIRT2388497	hsa-miR-4741	CLIP-seq
MIRT2388498	hsa-miR-541	CLIP-seq
MIRT1020953	hsa-miR-548o	CLIP-seq
MIRT2388499	hsa-miR-654-5p	CLIP-seq
MIRT2388500	hsa-miR-762	CLIP-seq
MIRT2235466	hsa-miR-3714	CLIP-seq
MIRT2450349	hsa-miR-4307	CLIP-seq
MIRT2450350	hsa-miR-548an	CLIP-seq
MIRT2450351	hsa-miR-940	CLIP-seq
MIRT2539256	hsa-miR-1237	CLIP-seq
MIRT2235436	hsa-miR-124	CLIP-seq
MIRT2539257	hsa-miR-1248	CLIP-seq
MIRT2539258	hsa-miR-1266	CLIP-seq
MIRT2539259	hsa-miR-1275	CLIP-seq
MIRT2539260	hsa-miR-1276	CLIP-seq
MIRT2539261	hsa-miR-1279	CLIP-seq
MIRT2539262	hsa-miR-1294	CLIP-seq
MIRT2539263	hsa-miR-1299	CLIP-seq
MIRT2235439	hsa-miR-1303	CLIP-seq
MIRT1020906	hsa-miR-1323	CLIP-seq
MIRT2539264	hsa-miR-1470	CLIP-seq
MIRT2235442	hsa-miR-153	CLIP-seq
MIRT2235443	hsa-miR-154	CLIP-seq
MIRT2235444	hsa-miR-185	CLIP-seq
MIRT2539265	hsa-miR-1976	CLIP-seq
MIRT2235447	hsa-miR-214	CLIP-seq
MIRT2539266	hsa-miR-2278	CLIP-seq
MIRT2539267	hsa-miR-24	CLIP-seq
MIRT2539268	hsa-miR-2964a-3p	CLIP-seq
MIRT2539269	hsa-miR-298	CLIP-seq
MIRT2539270	hsa-miR-3064-3p	CLIP-seq
MIRT2002492	hsa-miR-3117-5p	CLIP-seq
MIRT2235456	hsa-miR-3123	CLIP-seq
MIRT2539271	hsa-miR-3125	CLIP-seq
MIRT2235457	hsa-miR-3143	CLIP-seq
MIRT2539272	hsa-miR-3150b-3p	CLIP-seq
MIRT2235459	hsa-miR-3163	CLIP-seq
MIRT2002493	hsa-miR-3174	CLIP-seq
MIRT2539273	hsa-miR-3175	CLIP-seq
MIRT2539274	hsa-miR-3179	CLIP-seq
MIRT2002494	hsa-miR-3183	CLIP-seq
MIRT2235461	hsa-miR-3188	CLIP-seq
MIRT2002495	hsa-miR-3197	CLIP-seq
MIRT2539275	hsa-miR-3202	CLIP-seq
MIRT2539276	hsa-miR-335	CLIP-seq
MIRT2002496	hsa-miR-3612	CLIP-seq
MIRT2235464	hsa-miR-3619-5p	CLIP-seq
MIRT2539277	hsa-miR-3622b-5p	CLIP-seq
MIRT2539278	hsa-miR-3657	CLIP-seq
MIRT2002497	hsa-miR-3662	CLIP-seq
MIRT2539279	hsa-miR-3664-3p	CLIP-seq
MIRT2235466	hsa-miR-3714	CLIP-seq
MIRT2002498	hsa-miR-3909	CLIP-seq
MIRT2235467	hsa-miR-3910	CLIP-seq
MIRT2539280	hsa-miR-3916	CLIP-seq
MIRT2002499	hsa-miR-3925-5p	CLIP-seq
MIRT2539281	hsa-miR-4279	CLIP-seq
MIRT2539282	hsa-miR-4284	CLIP-seq
MIRT2235476	hsa-miR-4306	CLIP-seq
MIRT2002501	hsa-miR-4316	CLIP-seq
MIRT2002502	hsa-miR-432	CLIP-seq
MIRT2539283	hsa-miR-4420	CLIP-seq
MIRT2002503	hsa-miR-4443	CLIP-seq
MIRT2539284	hsa-miR-4461	CLIP-seq
MIRT2539285	hsa-miR-4468	CLIP-seq
MIRT2235484	hsa-miR-4469	CLIP-seq
MIRT2235486	hsa-miR-4474-3p	CLIP-seq
MIRT2539286	hsa-miR-4496	CLIP-seq
MIRT2002504	hsa-miR-4505	CLIP-seq
MIRT2539287	hsa-miR-4518	CLIP-seq
MIRT2539288	hsa-miR-4525	CLIP-seq
MIRT2539289	hsa-miR-4533	CLIP-seq
MIRT2235492	hsa-miR-4644	CLIP-seq
MIRT2539290	hsa-miR-4659a-3p	CLIP-seq
MIRT2539291	hsa-miR-4659b-3p	CLIP-seq
MIRT2539292	hsa-miR-4665-5p	CLIP-seq
MIRT1020934	hsa-miR-4666-5p	CLIP-seq
MIRT2539293	hsa-miR-4667-3p	CLIP-seq
MIRT2539294	hsa-miR-4689	CLIP-seq
MIRT2539295	hsa-miR-4690-5p	CLIP-seq
MIRT2539296	hsa-miR-4691-5p	CLIP-seq
MIRT2002505	hsa-miR-4694-3p	CLIP-seq
MIRT2002506	hsa-miR-4704-5p	CLIP-seq
MIRT2539297	hsa-miR-4709-5p	CLIP-seq
MIRT2002507	hsa-miR-4723-3p	CLIP-seq
MIRT2539298	hsa-miR-4723-5p	CLIP-seq
MIRT2539299	hsa-miR-4738-3p	CLIP-seq
MIRT2539300	hsa-miR-4762-5p	CLIP-seq
MIRT2539301	hsa-miR-4766-5p	CLIP-seq
MIRT2235498	hsa-miR-4773	CLIP-seq
MIRT2539302	hsa-miR-4778-3p	CLIP-seq
MIRT2539303	hsa-miR-4782-5p	CLIP-seq
MIRT2539304	hsa-miR-4784	CLIP-seq
MIRT2539305	hsa-miR-4786-3p	CLIP-seq
MIRT2539306	hsa-miR-4802-3p	CLIP-seq
MIRT2235503	hsa-miR-4803	CLIP-seq
MIRT2002509	hsa-miR-485-5p	CLIP-seq
MIRT2235505	hsa-miR-506	CLIP-seq
MIRT2539307	hsa-miR-513a-3p	CLIP-seq
MIRT2539308	hsa-miR-516b	CLIP-seq
MIRT2235507	hsa-miR-539	CLIP-seq
MIRT1020953	hsa-miR-548o	CLIP-seq
MIRT2002512	hsa-miR-587	CLIP-seq
MIRT2539309	hsa-miR-625	CLIP-seq
MIRT2235517	hsa-miR-642a	CLIP-seq
MIRT2002515	hsa-miR-650	CLIP-seq
MIRT2002516	hsa-miR-720	CLIP-seq
MIRT2235519	hsa-miR-761	CLIP-seq
MIRT2235520	hsa-miR-765	CLIP-seq
MIRT2539310	hsa-miR-873	CLIP-seq
MIRT2002518	hsa-miR-921	CLIP-seq
MIRT2539311	hsa-miR-936	CLIP-seq
MIRT2539256	hsa-miR-1237	CLIP-seq
MIRT2235436	hsa-miR-124	CLIP-seq
MIRT2539257	hsa-miR-1248	CLIP-seq
MIRT2539259	hsa-miR-1275	CLIP-seq
MIRT2539261	hsa-miR-1279	CLIP-seq
MIRT2539263	hsa-miR-1299	CLIP-seq
MIRT2235439	hsa-miR-1303	CLIP-seq
MIRT1020906	hsa-miR-1323	CLIP-seq
MIRT2002489	hsa-miR-141	CLIP-seq
MIRT2539264	hsa-miR-1470	CLIP-seq
MIRT2235442	hsa-miR-153	CLIP-seq
MIRT2235443	hsa-miR-154	CLIP-seq
MIRT2235444	hsa-miR-185	CLIP-seq
MIRT2539265	hsa-miR-1976	CLIP-seq
MIRT2002490	hsa-miR-200a	CLIP-seq
MIRT2235447	hsa-miR-214	CLIP-seq
MIRT2539267	hsa-miR-24	CLIP-seq
MIRT2539268	hsa-miR-2964a-3p	CLIP-seq
MIRT2539270	hsa-miR-3064-3p	CLIP-seq
MIRT2002492	hsa-miR-3117-5p	CLIP-seq
MIRT2235456	hsa-miR-3123	CLIP-seq
MIRT2539271	hsa-miR-3125	CLIP-seq
MIRT2235457	hsa-miR-3143	CLIP-seq
MIRT2235458	hsa-miR-3151	CLIP-seq
MIRT2681633	hsa-miR-3160-3p	CLIP-seq
MIRT2235459	hsa-miR-3163	CLIP-seq
MIRT2235460	hsa-miR-3170	CLIP-seq
MIRT2002493	hsa-miR-3174	CLIP-seq
MIRT2539273	hsa-miR-3175	CLIP-seq
MIRT2539274	hsa-miR-3179	CLIP-seq
MIRT2002494	hsa-miR-3183	CLIP-seq
MIRT2235461	hsa-miR-3188	CLIP-seq
MIRT2002495	hsa-miR-3197	CLIP-seq
MIRT2539275	hsa-miR-3202	CLIP-seq
MIRT2539276	hsa-miR-335	CLIP-seq
MIRT2002496	hsa-miR-3612	CLIP-seq
MIRT2235464	hsa-miR-3619-5p	CLIP-seq
MIRT2539277	hsa-miR-3622b-5p	CLIP-seq
MIRT2539278	hsa-miR-3657	CLIP-seq
MIRT2002497	hsa-miR-3662	CLIP-seq
MIRT2235466	hsa-miR-3714	CLIP-seq
MIRT2002498	hsa-miR-3909	CLIP-seq
MIRT2235467	hsa-miR-3910	CLIP-seq
MIRT2539280	hsa-miR-3916	CLIP-seq
MIRT2002499	hsa-miR-3925-5p	CLIP-seq
MIRT2235469	hsa-miR-4265	CLIP-seq
MIRT2539281	hsa-miR-4279	CLIP-seq
MIRT2539282	hsa-miR-4284	CLIP-seq
MIRT2235474	hsa-miR-4296	CLIP-seq
MIRT2235476	hsa-miR-4306	CLIP-seq
MIRT2002501	hsa-miR-4316	CLIP-seq
MIRT2002502	hsa-miR-432	CLIP-seq
MIRT2235479	hsa-miR-4322	CLIP-seq
MIRT2539283	hsa-miR-4420	CLIP-seq
MIRT2002503	hsa-miR-4443	CLIP-seq
MIRT2235482	hsa-miR-4447	CLIP-seq
MIRT2539284	hsa-miR-4461	CLIP-seq
MIRT2235484	hsa-miR-4469	CLIP-seq
MIRT2235485	hsa-miR-4472	CLIP-seq
MIRT2235486	hsa-miR-4474-3p	CLIP-seq
MIRT2002504	hsa-miR-4505	CLIP-seq
MIRT2539288	hsa-miR-4525	CLIP-seq
MIRT2539289	hsa-miR-4533	CLIP-seq
MIRT2235492	hsa-miR-4644	CLIP-seq
MIRT2539290	hsa-miR-4659a-3p	CLIP-seq
MIRT2539291	hsa-miR-4659b-3p	CLIP-seq
MIRT2539292	hsa-miR-4665-5p	CLIP-seq
MIRT2539293	hsa-miR-4667-3p	CLIP-seq
MIRT2539295	hsa-miR-4690-5p	CLIP-seq
MIRT2539296	hsa-miR-4691-5p	CLIP-seq
MIRT2002505	hsa-miR-4694-3p	CLIP-seq
MIRT2002506	hsa-miR-4704-5p	CLIP-seq
MIRT2002507	hsa-miR-4723-3p	CLIP-seq
MIRT2539298	hsa-miR-4723-5p	CLIP-seq
MIRT2539299	hsa-miR-4738-3p	CLIP-seq
MIRT2539300	hsa-miR-4762-5p	CLIP-seq
MIRT2539301	hsa-miR-4766-5p	CLIP-seq
MIRT2235498	hsa-miR-4773	CLIP-seq
MIRT2539302	hsa-miR-4778-3p	CLIP-seq
MIRT2539303	hsa-miR-4782-5p	CLIP-seq
MIRT2539305	hsa-miR-4786-3p	CLIP-seq
MIRT2539306	hsa-miR-4802-3p	CLIP-seq
MIRT2235503	hsa-miR-4803	CLIP-seq
MIRT2002509	hsa-miR-485-5p	CLIP-seq
MIRT2235504	hsa-miR-491-5p	CLIP-seq
MIRT2235505	hsa-miR-506	CLIP-seq
MIRT2681634	hsa-miR-511	CLIP-seq
MIRT2539307	hsa-miR-513a-3p	CLIP-seq
MIRT2539308	hsa-miR-516b	CLIP-seq
MIRT2235507	hsa-miR-539	CLIP-seq
MIRT1020953	hsa-miR-548o	CLIP-seq
MIRT2002512	hsa-miR-587	CLIP-seq
MIRT2539309	hsa-miR-625	CLIP-seq
MIRT2235517	hsa-miR-642a	CLIP-seq
MIRT2002515	hsa-miR-650	CLIP-seq
MIRT2002516	hsa-miR-720	CLIP-seq
MIRT2235519	hsa-miR-761	CLIP-seq
MIRT2235520	hsa-miR-765	CLIP-seq
MIRT2002518	hsa-miR-921	CLIP-seq
MIRT2539311	hsa-miR-936	CLIP-seq

Show/Hide all(167)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	10693759
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12435627, 19084012
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	18298960
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	2118997
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001656	Process	Metanephros development	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001822	Process	Kidney development	IEA
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0002062	Process	Chondrocyte differentiation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	10077605, 17000779, 17764085
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	10564661, 11238441, 12435627, 16371461, 17000779, 17764085, 19389374, 19592253, 19955409, 23955340, 24311597, 28965847, 29263200, 35140242
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10693759, 11238441, 12435627, 16254602, 18559511
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	10077605, 11238441, 12435627
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	18559511
GO:0005829	Component	Cytosol	TAS
GO:0005929	Component	Cilium	IDA	16254602, 19592253
GO:0005929	Component	Cilium	IEA
GO:0005930	Component	Axoneme	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	24311597
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007224	Process	Smoothened signaling pathway	IBA
GO:0007224	Process	Smoothened signaling pathway	IDA	31279575
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007224	Process	Smoothened signaling pathway	TAS	11001584
GO:0007389	Process	Pattern specification process	IEA
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0007420	Process	Brain development	IEA
GO:0007442	Process	Hindgut morphogenesis	IEA
GO:0007507	Process	Heart development	IEA
GO:0008013	Function	Beta-catenin binding	IPI	17331723
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008589	Process	Regulation of smoothened signaling pathway	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0009953	Process	Dorsal/ventral pattern formation	IEA
GO:0009954	Process	Proximal/distal pattern formation	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016485	Process	Protein processing	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0017053	Component	Transcription repressor complex	IEA
GO:0021513	Process	Spinal cord dorsal/ventral patterning	IEA
GO:0021522	Process	Spinal cord motor neuron differentiation	IEA
GO:0021537	Process	Telencephalon development	IEA
GO:0021543	Process	Pallium development	IEA
GO:0021544	Process	Subpallium development	IEA
GO:0021631	Process	Optic nerve morphogenesis	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021775	Process	Smoothened signaling pathway involved in ventral spinal cord interneuron specification	IEA
GO:0021776	Process	Smoothened signaling pathway involved in spinal cord motor neuron cell fate specification	IEA
GO:0021798	Process	Forebrain dorsal/ventral pattern formation	IEA
GO:0021801	Process	Cerebral cortex radial glia-guided migration	IEA
GO:0021819	Process	Layer formation in cerebral cortex	IEA
GO:0021861	Process	Forebrain radial glial cell differentiation	IEA
GO:0021915	Process	Neural tube development	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0022018	Process	Lateral ganglionic eminence cell proliferation	IEA
GO:0030318	Process	Melanocyte differentiation	IEA
GO:0030324	Process	Lung development	IEA
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0032331	Process	Negative regulation of chondrocyte differentiation	IEA
GO:0032332	Process	Positive regulation of chondrocyte differentiation	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033077	Process	T cell differentiation in thymus	ISS
GO:0035035	Function	Histone acetyltransferase binding	IPI	10075717
GO:0035108	Process	Limb morphogenesis	IEA
GO:0035108	Process	Limb morphogenesis	IMP	9354785, 18478223
GO:0035295	Process	Tube development	IEA
GO:0036033	Function	Mediator complex binding	IDA	17000779
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042307	Process	Positive regulation of protein import into nucleus	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0042733	Process	Embryonic digit morphogenesis	IEA
GO:0042733	Process	Embryonic digit morphogenesis	TAS	11001584
GO:0042826	Function	Histone deacetylase binding	IDA	12435627
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043010	Process	Camera-type eye development	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043585	Process	Nose morphogenesis	TAS	11001584
GO:0043586	Process	Tongue development	IEA
GO:0045060	Process	Negative thymic T cell selection	IEA
GO:0045060	Process	Negative thymic T cell selection	ISS
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045879	Process	Negative regulation of smoothened signaling pathway	IEA
GO:0045879	Process	Negative regulation of smoothened signaling pathway	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12435627, 16254602, 19084012
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17000779
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18559511
GO:0046632	Process	Alpha-beta T cell differentiation	IEA
GO:0046638	Process	Positive regulation of alpha-beta T cell differentiation	IEA
GO:0046638	Process	Positive regulation of alpha-beta T cell differentiation	ISS
GO:0046639	Process	Negative regulation of alpha-beta T cell differentiation	IEA
GO:0046639	Process	Negative regulation of alpha-beta T cell differentiation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048557	Process	Embryonic digestive tract morphogenesis	IEA
GO:0048566	Process	Embryonic digestive tract development	IEA
GO:0048566	Process	Embryonic digestive tract development	TAS	11001584
GO:0048589	Process	Developmental growth	IEA
GO:0048593	Process	Camera-type eye morphogenesis	IEA
GO:0048598	Process	Embryonic morphogenesis	IEA
GO:0048646	Process	Anatomical structure formation involved in morphogenesis	IEA
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048702	Process	Embryonic neurocranium morphogenesis	IEA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IEA
GO:0048839	Process	Inner ear development	IEA
GO:0060021	Process	Roof of mouth development	IEA
GO:0060173	Process	Limb development	IEA
GO:0060364	Process	Frontal suture morphogenesis	IEA
GO:0060366	Process	Lambdoid suture morphogenesis	IEA
GO:0060367	Process	Sagittal suture morphogenesis	IEA
GO:0060594	Process	Mammary gland specification	IEA
GO:0060831	Process	Smoothened signaling pathway involved in dorsal/ventral neural tube patterning	IEA
GO:0060840	Process	Artery development	IEA
GO:0060873	Process	Anterior semicircular canal development	IEA
GO:0060875	Process	Lateral semicircular canal development	IEA
GO:0061005	Process	Cell differentiation involved in kidney development	IEA
GO:0070242	Process	Thymocyte apoptotic process	IEA
GO:0070242	Process	Thymocyte apoptotic process	ISS
GO:0071625	Process	Vocalization behavior	IEA
GO:0072089	Process	Stem cell proliferation	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	17331723
GO:0097542	Component	Ciliary tip	IEA
GO:0097542	Component	Ciliary tip	TAS
GO:0097546	Component	Ciliary base	IEA
GO:0097546	Component	Ciliary base	TAS
GO:0120223	Process	Larynx morphogenesis	IEA
GO:1903010	Process	Regulation of bone development	IEA
GO:1990788	Component	GLI-SUFU complex	IPI	24311597
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000647	Process	Negative regulation of stem cell proliferation	IEA

MIM	HGNC	e!Ensembl
165240	4319	ENSG00000106571

Protein

UniProt ID

P10071

Protein name

Transcriptional activator GLI3 (GLI3 form of 190 kDa) (GLI3-190) (GLI3 full-length protein) (GLI3FL) [Cleaved into: Transcriptional repressor GLI3R (GLI3 C-terminally truncated form) (GLI3 form of 83 kDa) (GLI3-83)]

Protein function

Has a dual function as a transcriptional activator and a repressor of the sonic hedgehog (Shh) pathway, and plays a role in limb development. The full-length GLI3 form (GLI3FL) after phosphorylation and nuclear translocation, acts as an activato

PDB

4BLD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	513 → 540	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	546 → 570	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	576 → 601	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	607 → 632	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Is expressed in a wide variety of normal adult tissues, including lung, colon, spleen, placenta, testis, and myometrium.

Sequence

MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITM
QPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHMTSALSSSPTYPDLPFIRISPHR
NPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISATRGLSPTDAPHAGVSPAEYYHQ
MALLTGQRSPYADIIPSAATAGTGAIHMEYLHAMDSTRFSSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYSSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSE
SAVSSTGDPMHNKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYET
NCHWEGCAREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDSGSHS
QSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPI
SNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKL
ERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTM
LNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQSDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRLALL
GDALEPGVALPPVHAPRRCSDGGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPR
VPRFSSLSSCNPPAMATSAEKRSLVLQNYTRPEGGQSRNFHSSPCPPSITENVTLESLTM
DADANLNDEDFLPDDVVQYLNSQNQAGYEQHFPSALPDDSKVPHGPGDFDAPGLPDSHAG
QQFHALEQPCPEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRAFGFCNGMVVH
PQNPLRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCKAPQYGNCLNR
QPVAPGALDGACGAGIQASKLKSTPMQGSGGQLNFGLPVAPNESAGSMVNGMQNQDPVGQ
GYLAHQLLGDSMQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVV
RGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYS
GQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLE
GVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPALSMSTTNMAIG
DMSSLLTSLAEESKFLAVMQ

Sequence length

1580

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Hedgehog signaling pathway Pathways in cancer Basal cell carcinoma		GLI3 is processed to GLI3R by the proteasome Hedgehog 'off' state Hedgehog 'on' state GLI proteins bind promoters of Hh responsive genes to promote transcription

Show/Hide Causal Diseases (4)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Greig Cephalopolysyndactyly Syndrome	greig cephalopolysyndactyly syndrome, Greig cephalopolysyndactyly syndrome, severe	rs1583728165, rs2128704804, rs1583728402, rs121917711, rs1583500982, rs1787127981, rs121917712, rs28933372, rs121917713, rs1057520063, rs121917714, rs772948115, rs1554317931, rs121917715	N/A
Pallister-Hall Syndrome	pallister-hall syndrome	rs116840767, rs116840744, rs116840743, rs116840768, rs116840754	N/A
Polydactyly	Postaxial polydactyly, type A1/B, polydactyly, postaxial, type a1, Postaxial polydactyly type B	rs121917709, rs398122899, rs1057518698, rs1583734240, rs1060499558, rs121917714, rs1375768446, rs1583729398	N/A
Polysyndactyly	Polysyndactyly 4	rs121917713, rs1583729562	N/A

Show/Hide Unknown Diseases (12)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Acrocallosal Syndrome	acrocallosal syndrome	N/A	N/A	GenCC
Asthma	Asthma	N/A	N/A	GWAS
Congenital diaphragmatic hernia	congenital diaphragmatic hernia	N/A	N/A	ClinVar
Cronkhite-Canada Syndrome	cronkhite-canada syndrome	N/A	N/A	ClinVar
Hirschsprung Disease	Hirschsprung disease, susceptibility to, 1	N/A	N/A	ClinVar
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Ovarian cancer	Epithelial ovarian cancer	N/A	N/A	GWAS
postaxial polydactyly	Postaxial polydactyly	N/A	N/A	ClinVar
Sarcoidosis	Sarcoidosis	N/A	N/A	GWAS
Tibial hemimelia	tibial hemimelia	N/A	N/A	GenCC
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (90)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Absence of Tibia	Associate	37626311
Acrocephalopolysyndactyly Type II	Associate	21326280
Adenocarcinoma of Lung	Associate	25103784, 26647728
Agenesis of Corpus Callosum	Associate	32591344, 35436645
Alzheimer Disease	Associate	28577822
Anodontia	Associate	23549991, 24278334
Anophthalmos with limb anomalies	Associate	32591344
Arthropathy progressive pseudorheumatoid of childhood	Associate	10441570
Autistic Disorder	Associate	31010437
Bone Diseases	Associate	31399769
Bowen syndrome	Associate	17098889
Breast Neoplasms	Associate	29034935, 33990369
Carcinogenesis	Associate	23736020
Carcinoma Basal Cell	Associate	30754660
Carcinoma Ductal	Associate	18636275
Carcinoma Hepatocellular	Associate	29722127, 39174588
Carcinoma Non Small Cell Lung	Associate	23736020, 30407707, 39312343
Carcinoma Renal Cell	Associate	35266008
Central Nervous System Vascular Malformations	Associate	35436645
Choriocarcinoma	Inhibit	25265279
Chromosome Aberrations	Associate	18252217
Cleft Palate	Associate	36830605
Colorectal Neoplasms	Associate	33506047
Congenital Microtia	Associate	30691450
Craniosynostoses	Associate	21326280
Developmental Disabilities	Associate	35436645
Drug Resistant Epilepsy	Associate	18252217
Dysgnathia complex	Associate	24736735
Ectromelia	Associate	24736735
Endometriosis	Stimulate	29980254
Eye Diseases	Associate	38233474
Focal Cortical Dysplasia	Associate	35436645
Gallbladder Agenesis Of	Associate	29368652
Gastrointestinal Stromal Tumors	Associate	27793025
Genetic Diseases Inborn	Associate	29368652
Glioma	Associate	30730955
Greig cephalopolysyndactyly syndrome	Associate	10441570, 12115313, 15739154, 17098889, 19829694, 20672375, 21326280, 22903559, 24736735, 25267529, 29368652, 31325247, 32591344, 35436645, 36411030, 9192261 View all (1 more)
Hereditary Breast and Ovarian Cancer Syndrome	Associate	35134468
Hodgkin Disease	Associate	21531006
Hydatidiform Mole	Inhibit	25265279
Hydronephrosis	Associate	27279789
Hypothalamic hamartomas	Associate	18252217, 27453577, 35137044
Infertility Male	Associate	26755652
Intellectual Disability	Associate	23091001
Language Disorders	Associate	28577822
Leukemia Myeloid Acute	Associate	32708452
Lujan Fryns syndrome	Associate	23091001, 30729724
Lung Neoplasms	Associate	40311306
Lymphatic Metastasis	Associate	18636275
Lymphoma Large B Cell Diffuse	Associate	19593328
Medulloblastoma	Associate	12115313
Meningomyelocele	Associate	28735706
Mohr Tranebjaerg syndrome	Associate	31944163
Mullerian aplasia	Associate	35361250
Multicystic renal dysplasia bilateral	Inhibit	27279789
Muscle Hypotonia	Associate	35436645
Nasopharyngeal Carcinoma	Associate	31944163
Neoplasm Invasiveness	Associate	33990369
Neoplasms	Associate	25103784, 28877722, 29034935, 30272273, 31588709, 35134468, 35266008, 35867772, 36981021
Non Muscle Invasive Bladder Neoplasms	Associate	20858759
Olfaction Disorders	Associate	31399769
Opitz GBBB Syndrome X Linked	Associate	19829694
Opitz Kaveggia syndrome	Associate	23091001, 30729724
Orofaciodigital syndrome 9	Associate	10441570
Orofaciodigital Syndromes	Associate	20672375
Ossification of Posterior Longitudinal Ligament	Associate	32350355
Ovarian Neoplasms	Associate	35134468
Pallister Hall Syndrome	Associate	10441570, 12773293, 15739154, 18252217, 19829694, 20672375, 22903559, 24736735, 25267529, 29368652, 32591344, 35034092, 35436645, 9192261
Pancreatic Neoplasms	Associate	20814245, 35867772
Polydactyly	Associate	10441570, 18178536, 25267529, 28488682, 31115189, 32591344, 35034092, 35436645
Polydactyly Postaxial	Associate	10441570, 22903559, 25267529, 31115189, 32591344
Polydactyly Postaxial	Stimulate	25267529
Polydactyly preaxial 4	Associate	32591344
Polydactyly preaxial type 1	Associate	22903559
Prostatic Neoplasms	Associate	28877722, 29429990
Rectal Diseases	Associate	34651371
Rectal Neoplasms	Associate	34613665
Reticular dysgenesis	Associate	35136347
Retinopathy of Prematurity	Associate	38233474
Sarcoma	Associate	35839307, 36619306
Sarcoma Endometrial Stromal	Associate	34651371
Sex Chromosome Disorders of Sex Development	Associate	33424767
Sezary Syndrome	Associate	27342034
Short rib polydactyly syndrome Beemer type	Associate	10441570, 22903559
Squamous Cell Carcinoma of Head and Neck	Associate	30272273, 32899202
Stomach Neoplasms	Associate	24598828, 33900127, 36981021
Syndactyly	Associate	25267529, 32253825
Thyroid Cancer Papillary	Inhibit	37208504
Thyroiditis	Associate	32696176
Urinary Bladder Neoplasms	Associate	20858759

GLI3 (GLI family zinc finger 3)