Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	27350
Gene name Gene Name - the full gene name approved by the HGNC.	Apolipoprotein B mRNA editing enzyme catalytic subunit 3C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	APOBEC3C
Synonyms (NCBI Gene) Gene synonyms aliases	A3C, APOBEC1L, ARDC2, ARDC4, ARP5, PBI, bK150C2.3
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and fun

Show/Hide all(110)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049344	hsa-miR-92a-3p	CLASH	23622248
MIRT1932976	hsa-miR-3125	CLIP-seq
MIRT1932977	hsa-miR-3150b-3p	CLIP-seq
MIRT1932978	hsa-miR-3916	CLIP-seq
MIRT1932979	hsa-miR-3975	CLIP-seq
MIRT1932980	hsa-miR-4438	CLIP-seq
MIRT1932981	hsa-miR-4468	CLIP-seq
MIRT1932982	hsa-miR-4695-5p	CLIP-seq
MIRT1932983	hsa-miR-4722-5p	CLIP-seq
MIRT1932984	hsa-miR-4784	CLIP-seq
MIRT1932985	hsa-miR-5095	CLIP-seq
MIRT1932986	hsa-miR-877	CLIP-seq
MIRT2173138	hsa-miR-1299	CLIP-seq
MIRT2173139	hsa-miR-1343	CLIP-seq
MIRT2173140	hsa-miR-3663-5p	CLIP-seq
MIRT2173141	hsa-miR-378g	CLIP-seq
MIRT2173142	hsa-miR-4284	CLIP-seq
MIRT2173143	hsa-miR-4527	CLIP-seq
MIRT2173144	hsa-miR-4674	CLIP-seq
MIRT2173145	hsa-miR-875-3p	CLIP-seq
MIRT2476305	hsa-miR-1224-3p	CLIP-seq
MIRT2476306	hsa-miR-1255a	CLIP-seq
MIRT2476307	hsa-miR-1255b	CLIP-seq
MIRT2476308	hsa-miR-1260	CLIP-seq
MIRT2476309	hsa-miR-1260b	CLIP-seq
MIRT2476310	hsa-miR-1265	CLIP-seq
MIRT2476311	hsa-miR-1275	CLIP-seq
MIRT2476312	hsa-miR-1280	CLIP-seq
MIRT2173138	hsa-miR-1299	CLIP-seq
MIRT2173139	hsa-miR-1343	CLIP-seq
MIRT2476313	hsa-miR-150	CLIP-seq
MIRT2476314	hsa-miR-2392	CLIP-seq
MIRT2476315	hsa-miR-302f	CLIP-seq
MIRT2476316	hsa-miR-3121-5p	CLIP-seq
MIRT2476317	hsa-miR-3135	CLIP-seq
MIRT2476318	hsa-miR-3150a-3p	CLIP-seq
MIRT2476319	hsa-miR-3152-5p	CLIP-seq
MIRT2476320	hsa-miR-3153	CLIP-seq
MIRT2476321	hsa-miR-3175	CLIP-seq
MIRT2476322	hsa-miR-3186-3p	CLIP-seq
MIRT2173140	hsa-miR-3663-5p	CLIP-seq
MIRT2173141	hsa-miR-378g	CLIP-seq
MIRT2173142	hsa-miR-4284	CLIP-seq
MIRT1932980	hsa-miR-4438	CLIP-seq
MIRT2476323	hsa-miR-4450	CLIP-seq
MIRT2476324	hsa-miR-4525	CLIP-seq
MIRT2173143	hsa-miR-4527	CLIP-seq
MIRT2476325	hsa-miR-4665-5p	CLIP-seq
MIRT2476326	hsa-miR-4667-5p	CLIP-seq
MIRT2476327	hsa-miR-4668-5p	CLIP-seq
MIRT2173144	hsa-miR-4674	CLIP-seq
MIRT2476328	hsa-miR-4685-5p	CLIP-seq
MIRT2476329	hsa-miR-4700-5p	CLIP-seq
MIRT2476330	hsa-miR-4713-5p	CLIP-seq
MIRT2476331	hsa-miR-4723-5p	CLIP-seq
MIRT2476332	hsa-miR-4728-3p	CLIP-seq
MIRT2476333	hsa-miR-4731-5p	CLIP-seq
MIRT2476334	hsa-miR-4747-3p	CLIP-seq
MIRT2476335	hsa-miR-4774-3p	CLIP-seq
MIRT1932985	hsa-miR-5095	CLIP-seq
MIRT2476336	hsa-miR-532-3p	CLIP-seq
MIRT2476337	hsa-miR-625	CLIP-seq
MIRT2476338	hsa-miR-637	CLIP-seq
MIRT2476339	hsa-miR-659	CLIP-seq
MIRT2173145	hsa-miR-875-3p	CLIP-seq
MIRT2476340	hsa-miR-939	CLIP-seq
MIRT2476305	hsa-miR-1224-3p	CLIP-seq
MIRT2476306	hsa-miR-1255a	CLIP-seq
MIRT2476307	hsa-miR-1255b	CLIP-seq
MIRT2476308	hsa-miR-1260	CLIP-seq
MIRT2476309	hsa-miR-1260b	CLIP-seq
MIRT2476310	hsa-miR-1265	CLIP-seq
MIRT2476311	hsa-miR-1275	CLIP-seq
MIRT2476312	hsa-miR-1280	CLIP-seq
MIRT2173138	hsa-miR-1299	CLIP-seq
MIRT2173139	hsa-miR-1343	CLIP-seq
MIRT2476313	hsa-miR-150	CLIP-seq
MIRT2476314	hsa-miR-2392	CLIP-seq
MIRT2476315	hsa-miR-302f	CLIP-seq
MIRT2476316	hsa-miR-3121-5p	CLIP-seq
MIRT2476317	hsa-miR-3135	CLIP-seq
MIRT2476318	hsa-miR-3150a-3p	CLIP-seq
MIRT2476319	hsa-miR-3152-5p	CLIP-seq
MIRT2476321	hsa-miR-3175	CLIP-seq
MIRT2476322	hsa-miR-3186-3p	CLIP-seq
MIRT2173140	hsa-miR-3663-5p	CLIP-seq
MIRT2173141	hsa-miR-378g	CLIP-seq
MIRT2173142	hsa-miR-4284	CLIP-seq
MIRT1932980	hsa-miR-4438	CLIP-seq
MIRT2476323	hsa-miR-4450	CLIP-seq
MIRT2476324	hsa-miR-4525	CLIP-seq
MIRT2173143	hsa-miR-4527	CLIP-seq
MIRT2476325	hsa-miR-4665-5p	CLIP-seq
MIRT2476326	hsa-miR-4667-5p	CLIP-seq
MIRT2173144	hsa-miR-4674	CLIP-seq
MIRT2476328	hsa-miR-4685-5p	CLIP-seq
MIRT2476329	hsa-miR-4700-5p	CLIP-seq
MIRT2476330	hsa-miR-4713-5p	CLIP-seq
MIRT2476331	hsa-miR-4723-5p	CLIP-seq
MIRT2476332	hsa-miR-4728-3p	CLIP-seq
MIRT2476333	hsa-miR-4731-5p	CLIP-seq
MIRT2476334	hsa-miR-4747-3p	CLIP-seq
MIRT2476335	hsa-miR-4774-3p	CLIP-seq
MIRT1932985	hsa-miR-5095	CLIP-seq
MIRT2476336	hsa-miR-532-3p	CLIP-seq
MIRT2476337	hsa-miR-625	CLIP-seq
MIRT2476338	hsa-miR-637	CLIP-seq
MIRT2476339	hsa-miR-659	CLIP-seq
MIRT2173145	hsa-miR-875-3p	CLIP-seq
MIRT2476340	hsa-miR-939	CLIP-seq

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IBA
GO:0002376	Process	Immune system process	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003824	Function	Catalytic activity	IEA
GO:0004126	Function	Cytidine deaminase activity	IBA
GO:0005515	Function	Protein binding	IPI	22915799, 25416956, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21835787
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21835787
GO:0005737	Component	Cytoplasm	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010526	Process	Transposable element silencing	IDA	16527742
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0016554	Process	Cytidine to uridine editing	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0044029	Process	Positive regulation of gene expression via chromosomal CpG island demethylation	IDA	21496894
GO:0044355	Process	Clearance of foreign intracellular DNA	IDA	20062055
GO:0045071	Process	Negative regulation of viral genome replication	IDA	21632763
GO:0045087	Process	Innate immune response	IEA
GO:0045869	Process	Negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0070383	Process	DNA cytosine deamination	IBA
GO:0140546	Process	Defense response to symbiont	IEA

MIM	HGNC	e!Ensembl
607750	17353	ENSG00000244509

Protein

UniProt ID

Q9NRW3

Protein name

DNA dC->dU-editing enzyme APOBEC-3C (A3C) (EC 3.5.4.38) (APOBEC1-like) (Phorbolin I)

Protein function

DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. After the penetration of retroviral nucleocapsids into target cells of infe

PDB

3VM8 , 3VOW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18782	NAD2	10 → 189		Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in spleen, testes, peripherical blood lymphocytes, heart, thymus, prostate and ovary. {ECO:0000269|PubMed:11863358, ECO:0000269|PubMed:20308164}.

Sequence

MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSWKTGVFRNQVD
SETHCHAERCFLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFT
ARLYYFQYPCYQEGLRSLSQEGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRL
LKRRLRESLQ

Sequence length

190

Interactions

View interactions

	KEGG		Reactome
	Viral life cycle - HIV-1 Human immunodeficiency virus 1 infection		mRNA Editing: C to U Conversion Formation of the Editosome

APOBEC3C (apolipoprotein B mRNA editing enzyme catalytic subunit 3C)