Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	27349
Gene name Gene Name - the full gene name approved by the HGNC.	Malonyl-CoA-acyl carrier protein transacylase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MCAT
Synonyms (NCBI Gene) Gene synonyms aliases	FASN2C, MCT, MCT1, MT, NET62, OPA15, fabD
Disease Acronyms (UniProt) Disease acronyms from UniProt database	OPA15
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex tha

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027789	hsa-miR-98-5p	Microarray	19088304
MIRT032453	hsa-let-7b-5p	Proteomics	18668040
MIRT1136441	hsa-miR-3664-3p	CLIP-seq
MIRT1136442	hsa-miR-4279	CLIP-seq
MIRT1136443	hsa-miR-4433	CLIP-seq
MIRT1136444	hsa-miR-4459	CLIP-seq
MIRT1136445	hsa-miR-4768-3p	CLIP-seq
MIRT2268819	hsa-miR-103a	CLIP-seq
MIRT2268820	hsa-miR-107	CLIP-seq
MIRT2268821	hsa-miR-1184	CLIP-seq
MIRT2268822	hsa-miR-1286	CLIP-seq
MIRT2268823	hsa-miR-2278	CLIP-seq
MIRT2268824	hsa-miR-4436a	CLIP-seq
MIRT2268825	hsa-miR-4438	CLIP-seq
MIRT2268826	hsa-miR-4676-5p	CLIP-seq
MIRT2268827	hsa-miR-575	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
MTF1	Activation	15378601

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889
GO:0004312	Function	Fatty acid synthase activity	IDA	12882974
GO:0004314	Function	[acyl-carrier-protein] S-malonyltransferase activity	IBA	21873635
GO:0004314	Function	[acyl-carrier-protein] S-malonyltransferase activity	IDA	12882974
GO:0004314	Function	[acyl-carrier-protein] S-malonyltransferase activity	TAS
GO:0005739	Component	Mitochondrion	IBA	21873635
GO:0005739	Component	Mitochondrion	IDA	12882974
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006633	Process	Fatty acid biosynthetic process	IBA	21873635
GO:0006633	Process	Fatty acid biosynthetic process	IDA	12882974
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006635	Process	Fatty acid beta-oxidation	TAS

MIM	HGNC	e!Ensembl
614479	29622	ENSG00000100294

Protein

UniProt ID

Q8IVS2

Protein name

Malonyl-CoA-acyl carrier protein transacylase, mitochondrial (MCT) (EC 2.3.1.39) (Mitochondrial malonyl CoA:ACP acyltransferase) (Mitochondrial malonyltransferase) ([Acyl-carrier-protein] malonyltransferase)

Protein function

Catalyzes the transfer of a malonyl moiety from malonyl-CoA to the free thiol group of the phosphopantetheine arm of the mitochondrial ACP protein (NDUFAB1) (PubMed:12882974, PubMed:19549604). This suggests the existence of the biosynthesis of f

PDB

2C2N , 8CSP , 8CSQ , 8CSR , 8CSS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00698	Acyl_transf_1	64 → 346	Acyl transferase domain	Domain

Sequence

MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPG
QCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHC
QPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAE
AMQEASEAVPSGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISG
HQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSN
VHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKS
CNMQAWKSYSAVDVLQTLEHVDLDPQEPPR

Sequence length

390

Interactions

View interactions

	KEGG		Reactome
	Fatty acid biosynthesis Metabolic pathways Fatty acid metabolism		Mitochondrial Fatty Acid Beta-Oxidation

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Optic atrophy	Autosomal recessive isolated optic atrophy	rs121434508, rs267607017, rs80356524, rs80356525, rs879255560, rs104893753, rs80356529, rs397515360, rs104893620, rs199476104, rs199476112, rs199476118, rs398124298, rs770066665, rs398124299 View all (37 more)
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	14623372

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Optic Atrophy	autosomal recessive optic atrophy			GenCC

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
Blindness	Associate	33918393
Death	Inhibit	37726294
Mitochondrial Diseases	Inhibit	37726294
Nerve Degeneration	Associate	33918393
Optic Atrophies Hereditary	Associate	33918393
Optic Atrophy Hereditary Leber	Associate	33918393, 37071596, 37734847
Optic Nerve Diseases	Associate	33918393
Vision Disorders	Associate	33918393

MCAT (malonyl-CoA-acyl carrier protein transacylase)