MCAT (malonyl-CoA-acyl carrier protein transacylase)

Gene

• Entrez ID: 27349
• Gene name: Malonyl-CoA-acyl carrier protein transacylase
• Gene symbol: MCAT
• Synonyms (NCBI Gene): FASN2C, MCT, MCT1, MT, NET62, OPA15, fabD
• Chromosome: 22
• Chromosome location: 22q13.2
• Summary: The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex tha

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027789	hsa-miR-98-5p	Microarray	19088304
MIRT032453	hsa-let-7b-5p	Proteomics	18668040
MIRT1136441	hsa-miR-3664-3p	CLIP-seq
MIRT1136442	hsa-miR-4279	CLIP-seq
MIRT1136443	hsa-miR-4433	CLIP-seq
MIRT1136444	hsa-miR-4459	CLIP-seq
MIRT1136445	hsa-miR-4768-3p	CLIP-seq
MIRT2268819	hsa-miR-103a	CLIP-seq
MIRT2268820	hsa-miR-107	CLIP-seq
MIRT2268821	hsa-miR-1184	CLIP-seq
MIRT2268822	hsa-miR-1286	CLIP-seq
MIRT2268823	hsa-miR-2278	CLIP-seq
MIRT2268824	hsa-miR-4436a	CLIP-seq
MIRT2268825	hsa-miR-4438	CLIP-seq
MIRT2268826	hsa-miR-4676-5p	CLIP-seq
MIRT2268827	hsa-miR-575	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MTF1	Activation	15378601

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889
GO:0004314	Function	[acyl-carrier-protein] S-malonyltransferase activity	IBA
GO:0004314	Function	[acyl-carrier-protein] S-malonyltransferase activity	IDA	12882974, 19549604
GO:0004314	Function	[acyl-carrier-protein] S-malonyltransferase activity	IEA
GO:0004314	Function	[acyl-carrier-protein] S-malonyltransferase activity	TAS
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	12882974
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IBA
GO:0006633	Process	Fatty acid biosynthetic process	IDA	12882974
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006635	Process	Fatty acid beta-oxidation	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0032787	Process	Monocarboxylic acid metabolic process	IEA
GO:0180026	Process	Mitochondrial small ribosomal subunit assembly	IDA	36482135

Other IDs

• MIM: 614479
• HGNC: 29622
• e!Ensembl: ENSG00000100294

Protein

• UniProt ID: Q8IVS2
• Protein name: Malonyl-CoA-acyl carrier protein transacylase, mitochondrial (MCT) (EC 2.3.1.39) (Mitochondrial malonyl CoA:ACP acyltransferase) (Mitochondrial malonyltransferase) ([Acyl-carrier-protein] malonyltransferase)
• Protein function: Catalyzes the transfer of a malonyl moiety from malonyl-CoA to the free thiol group of the phosphopantetheine arm of the mitochondrial ACP protein (NDUFAB1) (PubMed:12882974, PubMed:19549604). This suggests the existence of the biosynthesis of f
• PDB: 2C2N, 8CSP, 8CSQ, 8CSR, 8CSS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00698	Acyl_transf_1	64 → 346	Acyl transferase domain	Domain

• Sequence:

  MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPG
  QCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHC
  QPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAE
  AMQEASEAVPSGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISG
  HQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSN
  VHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKS
  CNMQAWKSYSAVDVLQTLEHVDLDPQEPPR

• Sequence length: 390

Pathways

KEGG:

Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism

Reactome:

Mitochondrial Fatty Acid Beta-Oxidation

Associated diseases

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Acute myeloid leukemia	Pathogenic	rs2518107452	RCV005932753
Optic atrophy 15	Pathogenic	rs2518107452, rs2518100359	RCV003397174 RCV003397175

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
-	no classification for the single variant	rs759491564, rs568778084	-
MCAT-related condition	Likely benign	rs77536207	RCV004758883
Retinal dystrophy	Likely benign; Uncertain significance	rs77536207, rs377691255	RCV004816992 RCV004818315

Associations from Text Mining
Disease Name	Relationship Type	References
Blindness	Associate	33918393
Death	Inhibit	37726294
Mitochondrial Diseases	Inhibit	37726294
Nerve Degeneration	Associate	33918393
Optic Atrophies Hereditary	Associate	33918393
Optic Atrophy Hereditary Leber	Associate	33918393, 37071596, 37734847
Optic Nerve Diseases	Associate	33918393
Vision Disorders	Associate	33918393