Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	27347
Gene name Gene Name - the full gene name approved by the HGNC.	Serine/threonine kinase 39
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	STK39
Synonyms (NCBI Gene) Gene synonyms aliases	DCHT, PASK, SPAK
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q24.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a serine/threonine kinase that is thought to function in the cellular stress response pathway. The kinase is activated in response to hypotonic stress, leading to phosphorylation of several cation-chloride-coupled cotransporters. The cat

Show/Hide all(156)

miRTarBase ID	miRNA	Experiments
MIRT1398222	hsa-miR-1179	CLIP-seq
MIRT1398223	hsa-miR-1245b-3p	CLIP-seq
MIRT1398224	hsa-miR-1321	CLIP-seq
MIRT1398225	hsa-miR-1827	CLIP-seq
MIRT1398226	hsa-miR-2276	CLIP-seq
MIRT1398227	hsa-miR-2467-3p	CLIP-seq
MIRT1398228	hsa-miR-25	CLIP-seq
MIRT1398229	hsa-miR-2682	CLIP-seq
MIRT1398230	hsa-miR-296-3p	CLIP-seq
MIRT1398231	hsa-miR-3184	CLIP-seq
MIRT1398232	hsa-miR-32	CLIP-seq
MIRT1398233	hsa-miR-363	CLIP-seq
MIRT1398234	hsa-miR-367	CLIP-seq
MIRT1398235	hsa-miR-3689a-3p	CLIP-seq
MIRT1398236	hsa-miR-3689c	CLIP-seq
MIRT1398237	hsa-miR-376c	CLIP-seq
MIRT1398238	hsa-miR-3923	CLIP-seq
MIRT1398239	hsa-miR-3940-5p	CLIP-seq
MIRT1398240	hsa-miR-423-5p	CLIP-seq
MIRT1398241	hsa-miR-4263	CLIP-seq
MIRT1398242	hsa-miR-4317	CLIP-seq
MIRT1398243	hsa-miR-4419a	CLIP-seq
MIRT1398244	hsa-miR-449c	CLIP-seq
MIRT1398245	hsa-miR-4507	CLIP-seq
MIRT1398246	hsa-miR-4510	CLIP-seq
MIRT1398247	hsa-miR-4635	CLIP-seq
MIRT1398248	hsa-miR-4651	CLIP-seq
MIRT1398249	hsa-miR-4696	CLIP-seq
MIRT1398250	hsa-miR-4721	CLIP-seq
MIRT1398251	hsa-miR-4724-3p	CLIP-seq
MIRT1398252	hsa-miR-4728-5p	CLIP-seq
MIRT1398253	hsa-miR-4739	CLIP-seq
MIRT1398254	hsa-miR-4756-5p	CLIP-seq
MIRT1398255	hsa-miR-4775	CLIP-seq
MIRT1398256	hsa-miR-4799-5p	CLIP-seq
MIRT1398257	hsa-miR-4803	CLIP-seq
MIRT1398258	hsa-miR-488	CLIP-seq
MIRT1398259	hsa-miR-5096	CLIP-seq
MIRT1398260	hsa-miR-526b	CLIP-seq
MIRT1398261	hsa-miR-548a-5p	CLIP-seq
MIRT1398262	hsa-miR-548ab	CLIP-seq
MIRT1398263	hsa-miR-548ak	CLIP-seq
MIRT1398264	hsa-miR-548b-5p	CLIP-seq
MIRT1398265	hsa-miR-548c-5p	CLIP-seq
MIRT1398266	hsa-miR-548d-5p	CLIP-seq
MIRT1398267	hsa-miR-548h	CLIP-seq
MIRT1398268	hsa-miR-548i	CLIP-seq
MIRT1398269	hsa-miR-548j	CLIP-seq
MIRT1398270	hsa-miR-548k	CLIP-seq
MIRT1398271	hsa-miR-548l	CLIP-seq
MIRT1398272	hsa-miR-548w	CLIP-seq
MIRT1398273	hsa-miR-548y	CLIP-seq
MIRT1398274	hsa-miR-559	CLIP-seq
MIRT1398275	hsa-miR-576-5p	CLIP-seq
MIRT1398276	hsa-miR-583	CLIP-seq
MIRT1398277	hsa-miR-587	CLIP-seq
MIRT1398278	hsa-miR-608	CLIP-seq
MIRT1398279	hsa-miR-616	CLIP-seq
MIRT1398280	hsa-miR-890	CLIP-seq
MIRT1398281	hsa-miR-92a	CLIP-seq
MIRT1398282	hsa-miR-92b	CLIP-seq
MIRT1554237	hsa-miR-1276	CLIP-seq
MIRT1398226	hsa-miR-2276	CLIP-seq
MIRT1398223	hsa-miR-1245b-3p	CLIP-seq
MIRT1554237	hsa-miR-1276	CLIP-seq
MIRT2119358	hsa-miR-1297	CLIP-seq
MIRT1398224	hsa-miR-1321	CLIP-seq
MIRT2119359	hsa-miR-26a	CLIP-seq
MIRT2119360	hsa-miR-26b	CLIP-seq
MIRT1398230	hsa-miR-296-3p	CLIP-seq
MIRT1398243	hsa-miR-4419a	CLIP-seq
MIRT2119361	hsa-miR-4428	CLIP-seq
MIRT2119362	hsa-miR-4465	CLIP-seq
MIRT1398246	hsa-miR-4510	CLIP-seq
MIRT1398251	hsa-miR-4724-3p	CLIP-seq
MIRT1398252	hsa-miR-4728-5p	CLIP-seq
MIRT1398253	hsa-miR-4739	CLIP-seq
MIRT1398254	hsa-miR-4756-5p	CLIP-seq
MIRT1398258	hsa-miR-488	CLIP-seq
MIRT1398261	hsa-miR-548a-5p	CLIP-seq
MIRT1398262	hsa-miR-548ab	CLIP-seq
MIRT1398263	hsa-miR-548ak	CLIP-seq
MIRT1398264	hsa-miR-548b-5p	CLIP-seq
MIRT1398265	hsa-miR-548c-5p	CLIP-seq
MIRT1398266	hsa-miR-548d-5p	CLIP-seq
MIRT1398267	hsa-miR-548h	CLIP-seq
MIRT1398268	hsa-miR-548i	CLIP-seq
MIRT1398269	hsa-miR-548j	CLIP-seq
MIRT1398270	hsa-miR-548k	CLIP-seq
MIRT1398271	hsa-miR-548l	CLIP-seq
MIRT1398272	hsa-miR-548w	CLIP-seq
MIRT1398273	hsa-miR-548y	CLIP-seq
MIRT1398274	hsa-miR-559	CLIP-seq
MIRT1398276	hsa-miR-583	CLIP-seq
MIRT2119363	hsa-miR-590-3p	CLIP-seq
MIRT1398227	hsa-miR-2467-3p	CLIP-seq
MIRT1398239	hsa-miR-3940-5p	CLIP-seq
MIRT1398245	hsa-miR-4507	CLIP-seq
MIRT1398250	hsa-miR-4721	CLIP-seq
MIRT1398255	hsa-miR-4775	CLIP-seq
MIRT1398258	hsa-miR-488	CLIP-seq
MIRT2341558	hsa-miR-513b	CLIP-seq
MIRT1398271	hsa-miR-548l	CLIP-seq
MIRT1398280	hsa-miR-890	CLIP-seq
MIRT2433645	hsa-miR-340	CLIP-seq
MIRT2460694	hsa-miR-3140-3p	CLIP-seq
MIRT2460695	hsa-miR-323-3p	CLIP-seq
MIRT2460696	hsa-miR-3616-5p	CLIP-seq
MIRT2460697	hsa-miR-3647-5p	CLIP-seq
MIRT2460698	hsa-miR-573	CLIP-seq
MIRT1554237	hsa-miR-1276	CLIP-seq
MIRT2635458	hsa-miR-22	CLIP-seq
MIRT1398226	hsa-miR-2276	CLIP-seq
MIRT2635459	hsa-miR-3123	CLIP-seq
MIRT2460694	hsa-miR-3140-3p	CLIP-seq
MIRT2460695	hsa-miR-323-3p	CLIP-seq
MIRT2433645	hsa-miR-340	CLIP-seq
MIRT2460696	hsa-miR-3616-5p	CLIP-seq
MIRT2460697	hsa-miR-3647-5p	CLIP-seq
MIRT2635460	hsa-miR-3691-5p	CLIP-seq
MIRT2635461	hsa-miR-3925-5p	CLIP-seq
MIRT2635462	hsa-miR-4311	CLIP-seq
MIRT2635463	hsa-miR-4318	CLIP-seq
MIRT2635464	hsa-miR-4422	CLIP-seq
MIRT2635465	hsa-miR-4693-5p	CLIP-seq
MIRT2635466	hsa-miR-4752	CLIP-seq
MIRT2635467	hsa-miR-4769-3p	CLIP-seq
MIRT2635468	hsa-miR-4772-3p	CLIP-seq
MIRT2635469	hsa-miR-4778-5p	CLIP-seq
MIRT2635470	hsa-miR-483-3p	CLIP-seq
MIRT2635471	hsa-miR-544	CLIP-seq
MIRT2635472	hsa-miR-558	CLIP-seq
MIRT2460698	hsa-miR-573	CLIP-seq
MIRT1398276	hsa-miR-583	CLIP-seq
MIRT2635473	hsa-miR-630	CLIP-seq
MIRT2635474	hsa-miR-892a	CLIP-seq
MIRT2635475	hsa-miR-944	CLIP-seq
MIRT1554237	hsa-miR-1276	CLIP-seq
MIRT2635458	hsa-miR-22	CLIP-seq
MIRT2635459	hsa-miR-3123	CLIP-seq
MIRT2460694	hsa-miR-3140-3p	CLIP-seq
MIRT2460695	hsa-miR-323-3p	CLIP-seq
MIRT2460696	hsa-miR-3616-5p	CLIP-seq
MIRT2460697	hsa-miR-3647-5p	CLIP-seq
MIRT2635460	hsa-miR-3691-5p	CLIP-seq
MIRT2635461	hsa-miR-3925-5p	CLIP-seq
MIRT2635462	hsa-miR-4311	CLIP-seq
MIRT2635463	hsa-miR-4318	CLIP-seq
MIRT2635464	hsa-miR-4422	CLIP-seq
MIRT2635465	hsa-miR-4693-5p	CLIP-seq
MIRT2635466	hsa-miR-4752	CLIP-seq
MIRT2635467	hsa-miR-4769-3p	CLIP-seq
MIRT2635472	hsa-miR-558	CLIP-seq
MIRT2460698	hsa-miR-573	CLIP-seq
MIRT1398276	hsa-miR-583	CLIP-seq
MIRT2635474	hsa-miR-892a	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NFKB1	Activation	18787102
RELA	Activation	18787102

Show/Hide all(91)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002021	Process	Response to dietary excess	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	18270262, 19665974, 21321328, 24393035
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	10980603, 16669787
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	16669787, 21423148, 24393035, 24655550
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	IMP	10980603
GO:0005829	Component	Cytosol	ISS
GO:0005938	Component	Cell cortex	IEA
GO:0005938	Component	Cell cortex	ISS
GO:0006468	Process	Protein phosphorylation	ISS
GO:0006884	Process	Cell volume homeostasis	IDA	19665974, 21321328
GO:0006884	Process	Cell volume homeostasis	IDA	36318922
GO:0006884	Process	Cell volume homeostasis	IEA
GO:0006884	Process	Cell volume homeostasis	TAS	27782176
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IDA	24393035
GO:0007165	Process	Signal transduction	IMP	16669787
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0010820	Process	Positive regulation of T cell chemotaxis	IBA
GO:0010820	Process	Positive regulation of T cell chemotaxis	IEA
GO:0010820	Process	Positive regulation of T cell chemotaxis	IMP	27400149
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016301	Function	Kinase activity	ISS
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IMP	10980603
GO:0018107	Process	Peptidyl-threonine phosphorylation	IMP	10980603
GO:0019870	Function	Potassium channel inhibitor activity	IDA	24393035
GO:0019901	Function	Protein kinase binding	IEA
GO:0030644	Process	Intracellular chloride ion homeostasis	IEA
GO:0034763	Process	Negative regulation of transmembrane transport	IDA	25531585
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	24393035
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0035865	Process	Cellular response to potassium ion	IEA
GO:0036438	Process	Maintenance of lens transparency	IEA
GO:0036438	Process	Maintenance of lens transparency	ISS
GO:0038146	Process	Chemokine (C-X-C motif) ligand 12 signaling pathway	IEA
GO:0038146	Process	Chemokine (C-X-C motif) ligand 12 signaling pathway	IMP	27400149
GO:0042116	Process	Macrophage activation	IEA
GO:0043268	Process	Positive regulation of potassium ion transport	IEA
GO:0044297	Component	Cell body	IEA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0044325	Function	Transmembrane transporter binding	IPI	24393035
GO:0046777	Process	Protein autophosphorylation	IMP	10980603
GO:0046777	Process	Protein autophosphorylation	ISS
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050801	Process	Monoatomic ion homeostasis	IEA
GO:0070294	Process	Renal sodium ion absorption	IDA	18270262
GO:0070294	Process	Renal sodium ion absorption	IDA	18270262
GO:0070294	Process	Renal sodium ion absorption	IEA
GO:0071474	Process	Cellular hyperosmotic response	IBA
GO:0071474	Process	Cellular hyperosmotic response	IDA	36318922
GO:0071474	Process	Cellular hyperosmotic response	IEA
GO:0071476	Process	Cellular hypotonic response	IDA	24393035
GO:0071476	Process	Cellular hypotonic response	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IDA	19665974
GO:0090188	Process	Negative regulation of pancreatic juice secretion	IEA
GO:0099106	Function	Ion channel regulator activity	IMP	16669787
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0141109	Function	Transporter activator activity	IEA
GO:0141109	Function	Transporter activator activity	ISS
GO:0141110	Function	Transporter inhibitor activity	TAS	25531585
GO:1900745	Process	Positive regulation of p38MAPK cascade	IEA
GO:1900745	Process	Positive regulation of p38MAPK cascade	IMP	10980603
GO:1901380	Process	Negative regulation of potassium ion transmembrane transport	IDA	24393035
GO:1901380	Process	Negative regulation of potassium ion transmembrane transport	IEA
GO:1902306	Process	Negative regulation of sodium ion transmembrane transport	IDA	25531585
GO:1903288	Process	Positive regulation of potassium ion import across plasma membrane	IEA
GO:1903288	Process	Positive regulation of potassium ion import across plasma membrane	ISS
GO:1903784	Process	Positive regulation of sodium ion import across plasma membrane	IEA
GO:1903784	Process	Positive regulation of sodium ion import across plasma membrane	ISS
GO:1904044	Process	Response to aldosterone	IEA
GO:1904062	Process	Regulation of monoatomic cation transmembrane transport	IEA
GO:1904062	Process	Regulation of monoatomic cation transmembrane transport	ISS
GO:1990869	Process	Cellular response to chemokine	IMP	27400149

MIM	HGNC	e!Ensembl
607648	17717	ENSG00000198648

Protein

UniProt ID

Q9UEW8

Protein name

STE20/SPS1-related proline-alanine-rich protein kinase (Ste-20-related kinase) (EC 2.7.11.1) (DCHT) (Serine/threonine-protein kinase 39)

Protein function

Effector serine/threonine-protein kinase component of the WNK-SPAK/OSR1 kinase cascade, which is involved in various processes, such as ion transport, response to hypertonic stress and blood pressure (PubMed:16669787, PubMed:18270262, PubMed:213

PDB

7O86

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	63 → 337	Protein kinase domain	Domain
PF12202	OSR1_C	452 → 509	Oxidative-stress-responsive kinase 1 C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in brain and pancreas followed by heart, lung, kidney, skeletal muscle, liver, placenta and testis. {ECO:0000269|PubMed:10980603}.

Sequence

MAEPSGSPVHVQLPQQAAPVTAAAAAAPAAATAAPAPAAPAAPAPAPAPAAQAVGWPICR
DAYELQEVIGSGATAVVQAALCKPRQERVAIKRINLEKCQTSMDELLKEIQAMSQCSHPN
VVTYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGL
DYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLATGGDVTRNKVRKTFVGTPCWMA
PEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDK
EMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKNREYLIEKLLTRTPDIAQR
AKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAAFSQEKSRRVKEENPEIAVSAS
TIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLVLRLRNSRKELNDIRFEFTPGRDTAD
GVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFA
QLSVS

Sequence length

545

Interactions

View interactions

	KEGG
	Parathyroid hormone synthesis, secretion and action

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Osteoporosis	Osteoporosis	N/A	N/A	GWAS
Parkinson Disease	Parkinson's disease	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (27)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinogenesis	Associate	27542260
Carcinoma Hepatocellular	Associate	32200387, 34281492
Carcinoma Non Small Cell Lung	Stimulate	27542260
Cardiovascular Diseases	Associate	34678896
Chronic Disease	Associate	27773939
Chronobiology Disorders	Associate	19114657
Coronary Artery Disease	Associate	25328121
COVID 19	Associate	34775353
Diabetes Mellitus Type 1	Associate	32005708
Essential Hypertension	Associate	31242870
Glioma	Associate	34227028
Heart Failure	Associate	32602534
Hepatitis Alcoholic	Associate	40649881
Hereditary Sensory and Autonomic Neuropathies	Associate	36151370
Hypertension	Associate	16669787, 19114657, 20003416, 24873805, 27082544, 31242870, 34678896
Hypocalciuric hypercalcemia familial type 1	Associate	34281492
Inflammation	Associate	17321610
Ischemic Attack Transient	Associate	34678896
Minicore Myopathy with External Ophthalmoplegia	Associate	25328121
Neoplasm Metastasis	Stimulate	27542260
Neoplasms	Stimulate	27542260
Neoplasms	Associate	34281492, 37454130
Obesity	Associate	27773939
Pancreatic Neoplasms	Associate	35030986
Parkinson Disease	Associate	21812969, 22786590, 24586351, 25997059, 26090850, 26469904, 27393345
Parkinson Disease	Stimulate	24312176
Pseudohypoaldosteronism	Associate	26732173

STK39 (serine/threonine kinase 39)