Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	27306
Gene name	Hematopoietic prostaglandin D synthase
Gene symbol	HPGDS
Synonyms (NCBI Gene)	GSTSGSTS1GSTS1-1PGD2PGDS
Chromosome	4
Chromosome location	4q22.3
Summary	Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can b

Show/Hide all (25)

miRTarBase ID	miRNA	Experiments
MIRT1054141	hsa-miR-3128	CLIP-seq
MIRT1054142	hsa-miR-3150a-3p	CLIP-seq
MIRT1054143	hsa-miR-3175	CLIP-seq
MIRT1054144	hsa-miR-34a	CLIP-seq
MIRT1054145	hsa-miR-34c-5p	CLIP-seq
MIRT1054146	hsa-miR-3681	CLIP-seq
MIRT1054147	hsa-miR-4419a	CLIP-seq
MIRT1054148	hsa-miR-4460	CLIP-seq
MIRT1054149	hsa-miR-4487	CLIP-seq
MIRT1054150	hsa-miR-449a	CLIP-seq
MIRT1054151	hsa-miR-449b	CLIP-seq
MIRT1054152	hsa-miR-4510	CLIP-seq
MIRT1054153	hsa-miR-4633-3p	CLIP-seq
MIRT1054154	hsa-miR-4667-5p	CLIP-seq
MIRT1054155	hsa-miR-4700-5p	CLIP-seq
MIRT1054156	hsa-miR-4720-5p	CLIP-seq
MIRT1054157	hsa-miR-4727-3p	CLIP-seq
MIRT1054158	hsa-miR-4728-5p	CLIP-seq
MIRT1054159	hsa-miR-4731-5p	CLIP-seq
MIRT1054160	hsa-miR-4799-3p	CLIP-seq
MIRT1054161	hsa-miR-939	CLIP-seq
MIRT2012279	hsa-miR-548c-3p	CLIP-seq
MIRT2429706	hsa-miR-3185	CLIP-seq
MIRT2012279	hsa-miR-548c-3p	CLIP-seq
MIRT2012279	hsa-miR-548c-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
POU2F1	Unknown	10998423

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	IDA	12627223
GO:0001516	Process	Prostaglandin biosynthetic process	IEA
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004667	Function	Prostaglandin-D synthase activity	IDA	12627223
GO:0004667	Function	Prostaglandin-D synthase activity	IEA
GO:0004667	Function	Prostaglandin-D synthase activity	TAS	9353279
GO:0005509	Function	Calcium ion binding	IDA	12627223
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9353279
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IDA	12627223
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0007165	Process	Signal transduction	NAS	9353279
GO:0007626	Process	Locomotory behavior	TAS	10781097
GO:0009624	Process	Response to nematode	IEA
GO:0010269	Process	Response to selenium ion	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	12627223
GO:0046872	Function	Metal ion binding	IEA
GO:2000255	Process	Negative regulation of male germ cell proliferation	IEA

MIM	HGNC	e!Ensembl
602598	17890	ENSG00000163106

O60760

Protein name

Hematopoietic prostaglandin D synthase (H-PGDS) (EC 5.3.99.2) (GST class-sigma) (Glutathione S-transferase) (EC 2.5.1.18) (Glutathione-dependent PGD synthase) (Glutathione-requiring prostaglandin D synthase) (Prostaglandin-H2 D-isomerase)

Protein function

Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of ary

PDB

1IYH , 1IYI , 1V40 , 2CVD , 2VCQ , 2VCW , 2VCX , 2VCZ , 2VD0 , 2VD1 , 3EE2 , 3KXO , 3VI5 , 3VI7 , 4EC0 , 4EDY , 4EDZ , 4EE0 , 5AIS , 5AIV , 5AIX , 5YWE , 5YWX , 5YX1 , 6N4E , 6W58 , 6W8H , 6ZTC , 7JR6 , 7JR8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02798	GST_N	4 → 73	Glutathione S-transferase, N-terminal domain	Domain
PF14497	GST_C_3	92 → 194	Glutathione S-transferase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a number of megakaryocytic cell lines but not in platelets. Highly expressed in adipose tissue, macrophages and placenta. Also expressed at lower levels in lung, heart, lymph nodes, appendix, bone marrow and fetal liver. {

Sequence

MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL

Sequence length

199

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Arachidonic acid metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Metabolic pathways Chemical carcinogenesis - DNA adducts		Glutathione conjugation Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

HPGDS (hematopoietic prostaglandin D synthase)