Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27303
Gene name Gene Name - the full gene name approved by the HGNC.
RNA binding motif single stranded interacting protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RBMS3
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p24.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an RNA-binding protein that belongs to the c-myc gene single-strand binding protein family. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028524 hsa-miR-30a-5p Proteomics 18668040
MIRT031699 hsa-miR-16-5p Proteomics 18668040
MIRT721515 hsa-miR-1324 HITS-CLIP 19536157
MIRT654314 hsa-miR-877-3p HITS-CLIP 23824327
MIRT654313 hsa-miR-875-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002357 Process Defense response to tumor cell IMP 28409548
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0003730 Function MRNA 3'-UTR binding IBA
GO:0003730 Function MRNA 3'-UTR binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605786 13427 ENSG00000144642
Protein
UniProt ID Q6XE24
Protein name RNA-binding motif, single-stranded-interacting protein 3
Protein function Binds poly(A) and poly(U) oligoribonucleotides.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 63 128 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 142 207 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal brain, fetal lung, fetal liver, heart, brain, placenta, lung, liver, muscle, kidney and pancreas. {ECO:0000269|PubMed:10675610}.
Sequence
MGKRLDQPQMYPQYTYYYPHYLQTKQSYAPAPHPMAPPSPSTNSSSNNSSNNSSGEQLSK
TNLYIRGLPPGTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVA
SLKANGVQ
AQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDANGVSR
GVGFARMESTEKCEVVIQHFNGKYLKT
PPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQST
SWMPHPPYVMQPTGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTIQSQDRIMIL
HQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAV
DTSNEHAPAYSYQQSKP
Sequence length 437
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Dermatitis Atopic dermatitis (moderate to severe) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32087603, 33195699
Alphavirus Infections Associate 33109765
Alzheimer Disease Associate 22993125, 26507309, 30286791, 30367664, 31723601
Alzheimer Disease Inhibit 37735116
Amyotrophic Lateral Sclerosis Associate 22764223, 22993125, 23022481, 23249733, 23545117, 25009283, 26035390, 26056265, 26391765, 26883171, 29134320, 29701791, 30872628, 31382054, 33495278
View all (7 more)
Amyotrophic lateral sclerosis 1 Associate 23545117, 33580145
Autism Spectrum Disorder Associate 22543975, 38103876
Bone Diseases Metabolic Associate 36077598
Breast Neoplasms Associate 19010922, 20370918, 23284704, 27415018, 28191469, 29052531, 31733123, 33845141, 33910421, 35579257, 35705040, 36131924, 36581993, 36722268, 36769184
View all (2 more)
Bronchitis Associate 21918681