Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	27293
Gene name	Sphingomyelin phosphodiesterase acid like 3B
Gene symbol	SMPDL3B
Synonyms (NCBI Gene)	ASML3B
Chromosome	1
Chromosome location	1p35.3

Show/Hide all (68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052379	hsa-let-7a-5p	CLASH	23622248
MIRT528306	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT528305	hsa-miR-6753-5p	PAR-CLIP	20371350
MIRT528304	hsa-miR-100-5p	PAR-CLIP	20371350
MIRT528303	hsa-miR-99a-5p	PAR-CLIP	20371350
MIRT528302	hsa-miR-99b-5p	PAR-CLIP	20371350
MIRT528301	hsa-miR-1913	PAR-CLIP	20371350
MIRT528300	hsa-miR-324-3p	PAR-CLIP	20371350
MIRT528299	hsa-miR-4313	PAR-CLIP	20371350
MIRT528306	hsa-miR-1911-3p	PAR-CLIP	22012620
MIRT528305	hsa-miR-6753-5p	PAR-CLIP	22012620
MIRT528304	hsa-miR-100-5p	PAR-CLIP	22012620
MIRT528303	hsa-miR-99a-5p	PAR-CLIP	22012620
MIRT528302	hsa-miR-99b-5p	PAR-CLIP	22012620
MIRT528301	hsa-miR-1913	PAR-CLIP	22012620
MIRT528300	hsa-miR-324-3p	PAR-CLIP	22012620
MIRT528299	hsa-miR-4313	PAR-CLIP	22012620
MIRT528306	hsa-miR-1911-3p	PAR-CLIP	20371350
MIRT528305	hsa-miR-6753-5p	PAR-CLIP	20371350
MIRT528304	hsa-miR-100-5p	PAR-CLIP	20371350
MIRT528303	hsa-miR-99a-5p	PAR-CLIP	20371350
MIRT528302	hsa-miR-99b-5p	PAR-CLIP	20371350
MIRT528301	hsa-miR-1913	PAR-CLIP	20371350
MIRT528300	hsa-miR-324-3p	PAR-CLIP	20371350
MIRT528299	hsa-miR-4313	PAR-CLIP	20371350
MIRT528306	hsa-miR-1911-3p	PAR-CLIP	22012620
MIRT528305	hsa-miR-6753-5p	PAR-CLIP	22012620
MIRT528304	hsa-miR-100-5p	PAR-CLIP	22012620
MIRT528303	hsa-miR-99a-5p	PAR-CLIP	22012620
MIRT528302	hsa-miR-99b-5p	PAR-CLIP	22012620
MIRT528301	hsa-miR-1913	PAR-CLIP	22012620
MIRT528300	hsa-miR-324-3p	PAR-CLIP	22012620
MIRT528299	hsa-miR-4313	PAR-CLIP	22012620
MIRT1373904	hsa-miR-1207-5p	CLIP-seq
MIRT1373905	hsa-miR-146b-3p	CLIP-seq
MIRT1373906	hsa-miR-1827	CLIP-seq
MIRT1373907	hsa-miR-3173-5p	CLIP-seq
MIRT1373908	hsa-miR-345	CLIP-seq
MIRT1373909	hsa-miR-3665	CLIP-seq
MIRT1373910	hsa-miR-3918	CLIP-seq
MIRT1373911	hsa-miR-4270	CLIP-seq
MIRT1373912	hsa-miR-4436b-3p	CLIP-seq
MIRT1373913	hsa-miR-4441	CLIP-seq
MIRT1373914	hsa-miR-4640-5p	CLIP-seq
MIRT1373915	hsa-miR-4726-5p	CLIP-seq
MIRT1373916	hsa-miR-4732-3p	CLIP-seq
MIRT1373917	hsa-miR-4736	CLIP-seq
MIRT1373918	hsa-miR-4763-3p	CLIP-seq
MIRT1373919	hsa-miR-764	CLIP-seq
MIRT1373920	hsa-miR-874	CLIP-seq
MIRT1373921	hsa-miR-940	CLIP-seq
MIRT1373904	hsa-miR-1207-5p	CLIP-seq
MIRT2334453	hsa-miR-124	CLIP-seq
MIRT2334454	hsa-miR-3150a-3p	CLIP-seq
MIRT2334455	hsa-miR-3175	CLIP-seq
MIRT1373910	hsa-miR-3918	CLIP-seq
MIRT2334456	hsa-miR-4252	CLIP-seq
MIRT1373912	hsa-miR-4436b-3p	CLIP-seq
MIRT2334457	hsa-miR-4493	CLIP-seq
MIRT1373914	hsa-miR-4640-5p	CLIP-seq
MIRT2334458	hsa-miR-4667-5p	CLIP-seq
MIRT2334459	hsa-miR-4690-5p	CLIP-seq
MIRT2334460	hsa-miR-4700-5p	CLIP-seq
MIRT1373915	hsa-miR-4726-5p	CLIP-seq
MIRT1373918	hsa-miR-4763-3p	CLIP-seq
MIRT2334461	hsa-miR-493	CLIP-seq
MIRT2334462	hsa-miR-506	CLIP-seq
MIRT2334463	hsa-miR-939	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0004767	Function	Sphingomyelin phosphodiesterase activity	IEA
GO:0005515	Function	Protein binding	IPI	31217420
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006685	Process	Sphingomyelin catabolic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008081	Function	Phosphoric diester hydrolase activity	IBA
GO:0008081	Function	Phosphoric diester hydrolase activity	IEA
GO:0008081	Function	Phosphoric diester hydrolase activity	IMP	26095358
GO:0008081	Function	Phosphoric diester hydrolase activity	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	ISS
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	IEA
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0046466	Process	Membrane lipid catabolic process	IEA
GO:0046466	Process	Membrane lipid catabolic process	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0098552	Component	Side of membrane	IEA

MIM	HGNC	e!Ensembl
617737	21416	ENSG00000130768

Q92485

Protein name

Acid sphingomyelinase-like phosphodiesterase 3b (ASM-like phosphodiesterase 3b) (EC 3.1.4.-)

Protein function

Lipid-modulating phosphodiesterase (PubMed:26095358). Active on the surface of macrophages and dendritic cells and strongly influences macrophage lipid composition and membrane fluidity. Acts as a negative regulator of Toll-like receptor signali

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00149	Metallophos	21 → 281	Calcineurin-like phosphoesterase	Domain

Sequence

MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGSQPVPDAGPWG
DYLCDSPWALINSSIYAMKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIR
EVFPDTKVYAALGNHDFHPKNQFPAGSNNIYNQIAELWKPWLSNESIALFKKGAFYCEKL
PGPSGAGRIVVLNTNLYYTSNALTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPG
FFEKTQNKAWFREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYDDAGVPISAMFIT
PGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKDMVTYFMNLSQANAQGTPRWELEYQ
LTEAYGVPDASAHSMHTVLDRIAGDQSTLQRYYVYNSVSYSAGVCDEACSMQHVCAMRQV
DIDAYTTCLYASGTTPVPQLPLLLMALLGLCTLVL

Sequence length

455

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ASTIGMATISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Attention Deficit Disorder with Hyperactivity	Associate	32661301	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Inhibit	21632984	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	25144372	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	38022627	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Associate	36478205	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	25144372	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	32575490	★★★★★ ★☆☆☆☆ Found in Text Mining only

SMPDL3B (sphingomyelin phosphodiesterase acid like 3B)