Gene Gene information from NCBI Gene database.
Entrez ID 27287
Gene name VENT homeobox
Gene symbol VENTX
Synonyms (NCBI Gene)
HPX42BNA88AVENTX2
Chromosome 10
Chromosome location 10q26.3
Summary This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene
miRNA miRNA information provided by mirtarbase database.
301
miRTarBase ID miRNA Experiments Reference
MIRT707405 hsa-miR-6074 HITS-CLIP 21572407
MIRT517563 hsa-miR-1277-5p HITS-CLIP 21572407
MIRT517562 hsa-miR-8485 HITS-CLIP 21572407
MIRT517561 hsa-miR-329-3p HITS-CLIP 21572407
MIRT517560 hsa-miR-362-3p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607158 13639 ENSG00000151650
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95231
Protein name Homeobox protein VENTX (VENT homeobox homolog) (VENT-like homeobox protein 2)
Protein function May be involved in ventralization.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 92 148 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in bone marrow of patients recovering from chemotherapy. Also expressed in an erythroleukemia cell line. {ECO:0000269|PubMed:11549314}.
Sequence
MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQA
VSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLE
RKRLAREMQLSEVQIKTWFQNRRMKHKR
QMQDPQLHSPFSGSLHAPPAFYSTSSGLANGL
QLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPA
LSTGPRGLCAMPQTGDAF
Sequence length 258
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Senescence-Associated Secretory Phenotype (SASP)
Transcriptional Regulation by VENTX